P450s that have appeared since the 1993 P450 nomenclature update.
      This is part E of the bibiographic P450 files.  
      This section contains bacterial sequences CYP101 to CYP174.  
      This includes references that were incomplete and duplications
      of sequences that were already in the update.  If a sequence 
      is assigned an accession number that was not in the old update
      it is included in this list.  48 new P450s were added July 27, 2000
      Four new sequences were added Jan. 9, 2001 CYP102C1, CYP172-174.
      Added CYP175A1 9/17/2001
      Compiled by David R. Nelson
      Last modified June 2, 2003 added 25 new sequences. 
      Last modified Nov. 5, 2003 There are now 501 bacterial P450s

51 Family

101 Family

102 Family

103 Family

104 Family

105A Subfamily

105B Subfamily

105C Subfamily

105D Subfamily

105E Subfamily

106 Family

107A Subfamily

107B Subfamily

107C Subfamily

107D Subfamily

107E Subfamily

107F Subfamily

107G Subfamily

107H Subfamily

107J Subfamily

108 Family

109 Family

110 Family

111 Family

112 Family

113A Subfamily

113B Subfamily

114 Family

115 Family

116 Family

117 Family

118 Family

119 Family

120 Family

121 Family

122 Family

123 Family

124 Family

125 Family

126 Family

127 Family

128 Family

129 Family

130 Family

131 Family

132 Family

133 Family


51 Family


CYP51      Mycobacterium tuberculosis
           GenEMBL Z80226 (34809bp) gi 1550642 Rv0764c
           complement (6140-7495)
           33.7% identical to CYP51 over 439AA overlap
           this is a bacterial CYP51

CYP51      Mycobacterium bovis subsp. bovis AF2122/97
           NC_002945 complete genome complement(858662..858868)
           CYP51 100% match
           locus_tag = Mb0786c

CYP51 Mycobacterium avium
TIGR contig:3273:m_avium Length = 5,475,738
79% to CYP51 M. tuberculosis
3021360 TSTVVPRVSGGEEEHGHLEEFRTDPIGLMQRVRDECGDVGWFQLVDKHVILLSGAQANEF 3021539
3021540 FFRSADEDLDQAEAYPFMTPIFGKGVVFDASPERRKEMLHNSALRGEQMKGHASTIEGEV 3021719
3021720 KKMIADWGDEGEIELLDFFAELTIYTSTACLIGLKFREQLDHRFAEYYHDLERGTDPLCY 3021899
3021900 VDPYLPIESFKRRDEARVKLVALVQEIMDQRLANPPKDKADRDMLDVLVSIKDEDGKPRF 3022079
3022080 SADEITGMFISLMFAGHHTSSGTSAWTLIELIRHPDVYAEVLAELEELYADGQEVSFHAL 3022259
3022260 RSIPKLDNVVKETLRLHPPLIILMRVAKGEFEVEGFPIHEGDYVAASPAISNRIPEDFPD 3022439
3022440 PDAFKPDRYNKPEQADIVNRWTWIPFGAGRHRCVGAAFAQMQIKAIFSVLLREYDFEMAQ 3022619
3022620 PADSYRNDHSKMVVQLARPAKVRYRKR 3022700

CYP51 Mycobacterium smegmatis
TIGR contig:3439:m_smegmatis Length = 6,989,783
80% to CYP51 M. tuberculosis
4858809 VPRVSGGEEEHGHLEEFRTDPIGLMKRVRSECGDVGWFQLADKQVVLLSGAEANEFFFRS 4858988
4858989 SDSELNQAEAYPFMTPIFGEGVVFDADPERRAEMLHNTALRGEQMKGHAATIENEVRRMV 4859168
4859169 ESWGDEGEIDLLEFFAELTIYTSTACLIGVKFRNQLDKRFADYYHLLERGTDPLCYVDPY 4859348
4859349 LPIESFRIRDEARANLVELVQEVMNGRIANPPKDKSDRDLLDVLVSIKDEDGTPRFSANE 4859528
4859529 VTGMFISLMFAGHHTSSGTASWTLIELLRHPEFYAKVQAELDDLYADGQEISFHALRQIP 4859708
4859709 NLDNALKETLRLHPPLIILMRVAQDEFEVAGRPIHKGQMVAASPAISNRIPEDFPDPDTF 4859888
4859889 DPDRYDKPRQEDLINRWTWIPFGAGKHRCVGAAFAQMQIKAIFSVLLRDFEFEMAQPSES 4860068
4860069 YRNDHSKMVVQLARPAKVRYRRR 4860137

CYP51 Methylococcus capsulatus
TIGR contig:221:m_capsulatus
49% to CYP51 M. tuberculosis
NOTE FUSION PROTEIN EXTENDS C-TERMINAL. 
SEE J. Biol. Chem., Vol. 277, Issue 49, 46959-46965, December 6, 2002
A Novel Sterol 14-Demethylase/Ferredoxin Fusion Protein (MCCYP51FX) from
Methylococcus capsulatus Represents a New Class of the Cytochrome P450
Superfamily 
Colin J. Jackson¤, David C. Lamb¤, Timothy H. Marczylo, Andrew G. S. Warrilow, Nigel J. Manning¦, David J. Lowe, Diane
E. Kelly, and Steven L. Kelly
908332 MSHPPSNTP
908305 PVKPGGLPLLGHILEFGKNPHAFLMALRHEFGDVAEFRMFHQRMVLLTGSQASEAFYRAP 908126
908125 DEVLDQGPAYRIMTPIFGRGVVFDARIERKNQQLQMLMPALRDKPMRTYSEIIVAEVEAM 907946
907945 LRDWKDAGTIDLLELTKELTIYTSSHCLLGAEFRHELNTEFAGIYRDLEMGIQPIAYVFP 907766
907765 NLPLPVFKRRDQARVRLQELVTQIMERRARSQERSTNVFQMLIDASYDDGSKLTPH 907598
907597 EITGMLIATIFAGHHTSSGTTAWVLIELLRRPEYLRRVRAEIDALFETHGRVTFESLRQM 907418
907417 PQLENVIKEVLRLHPPLILLMRKVMKDFEVQGMRIEAGKFVCAAPSVTHRIPELFPNPEL 907238
907237 FDPDRYTPERAEDKDLYGWQAFGGGRHKCSGNAFAMFQIKAIVCVLLRNYEFELAAAPE 907061
907060 SYRDDYRKMVVEPASPCLIRYRRRDAP 906980

101 Family


CYP101A1    Pseudomonas putida
            GenEMBL D00528 (1950bp)
            Koga,H., Yamaguchi,E., Matsunaga,K., Aramaki,H. and Horiuchi,T.
            Cloning and nucleotide sequences of NADH-putidaredoxin reductase
            gene(camA) and putidaredoxin gene(camB) involved in cytochrome
            P-450cam hydroxylase of Pseudomonas putida
            J. Biochem. 106, 831-836 (1989)
            Note: only the last 93 nucleotides of the cam gene was cloned along 
            with two downstream genes.

CYP101A1    Pseudomonas putida
            PIR C60886 (last 8 amino acids)
            Romeo, C., Moriwaki, N., Yasunobu, K.T., Gunsalus, I.C.,
            Koga, H.
            Identification of the coding region for the putidaredoxin
            reductase gene from the plasmid of Pseudomonas putida.
            J. Protein Chem. 6, 253-261 (1987)

CYP101B1    Novosphingobium aromaticivorans
            NZ_AAAV01000165.1 
            complement(29626..30870) gene = Saro2804
            43% to CYP101
MLPHDRGQNSTRRITAMEAPAHVPADRVVDIDIYMPPGLAEHGF
HKAWSDLSAGNPAVVWTPRNEGHWIALGGEALQEVQSDPERFSSRIIVLPKSVGEMHG
LIPTTIDPPEHRPYRQLLNAHLNPGAIRGLSESIRQTAVDLIEGFAAQGHCNFTAQYA
EQFPIRVFMALVGIEASEAPRIRHWAECMTRPGMDMTFDEAKAVFFDYVGPLVDARRE
TPGEDMISAMINADLGDGRRLTRDEALSVVTQVLIAGLDTVVNVLGFIMRELAGNPAL
RADLRQRGADILPVVHELFRRFGLVSIAREVRRDIEFHGVHLKAGDMIAIPTQVHGLD
PRVNPDPLAIDPSRKRARHSTFGSGPHMCPGQELARKEVAITLEEWLRRIPDFALGPN
SDLSPVPGIVGALRRVELVWNT

CYP101C1   Novosphingobium aromaticivorans
           NZ_AAAV01000133.1 
           complement(4199..5389) gene = Saro1574
           44% to CYP101A1
MIPAHVPADRVVDFDIFNPPGVEQDYFAAWKTLLDGPGLVWSTA
NGGHWIAARGDVVRELWGDAERLSSQCLAVTPGLGKVMQFIPLQQDGAEHKAFRTPVM
KGLASRFVVALEPKVQAVARKLMESLRPRGSCDFVSDFAEILPLNIFLTLIDVPLEDR
PRLRQLGVQLTRPDGSMTVEQLKQAADDYLWPFIEKRMAQPGDDLFSRILSEPVGGRP
WTVDEARRMCRNLLFGGLDTVAAMIGMVALHLARHPEDQRLLRERPDLIPAAADELMR
RYPTVAVSRNAVADVDADGVTIRKGDLVYLPSVLHNLDPASFEAPEEVRFDRGLAPIR
HTTMGVGAHRCVGAGLARMEVIVFLREWLGGMPEFALAPDKAVTMKGGNVGACTALPL
VWRA

CYP101D1   Novosphingobium aromaticivorans
           NZ_AAAV01000085.1 
           complement(6803..8068) gene = Saro0669
           44% to CYP101
MNAQTSTATQKHRVAPPPHVPGHLIREIDAYDLDGLEQGFHEAW
KRVQQPDTPPLVWTPFTGGHWIATRGTLIDEIYRSPERFSSRVIWVPREAGEAYDMVP
TKLDPPEHTPYRKAIDKGLNLAEIRKLEDQIRTIAVEIIEGFADRGHCEFGSEFSTVF
PVRVFLALAGLPVEDATKLGLLANEMTRPSGNTPEEQGRSLEAANKGFFEYVAPIIAA
RRGGSGTDLITRILNVEIDGKPMPDDRALGLVSLLLLGGLDTVVNFLGFMMIYLSRHP
ETVAEMRREPLKLQRGVEELFRRFAVVSDARYVVSDMEFHGTMLKEGDLILLPTALHG
LDDRHHDDPMTVDLSRRDVTHSTFAQGPHRCAGMHLARLEVTVMLQEWLARIPEFRLK
DRAVPIYHSGIVAAVENIPLEWEPQRVSA

CYP101D2   Novosphingobium aromaticivorans
           NZ_AAAV01000042
           complement(5601..6899) gene = Saro0208
           63% to 101D1
MGTTRMDTFNPQESRLATNFDEAVRAKVERPANVPEDRVYEIDM
YALNGIEDGYHEAWKKVQHPGIPDLIWTPFTGGHWIATNGDTVKEVYSDPTRFSSEVI
FLPKEAGEKYQMVPTKMDPPEHTPYRKALDKGLNLAKIRKVEDKVREVASSLIDSFAA
RGECDFAAEYAELFPVHVFMALADLPLEDIPVLSEYARQMTRPEGNTPEEMATDLEAG
NNGFYAYVDPIIRARVGGDGDDLITLMVNSEINGERIAHDKAQGLISLLLLGGLDTVV
NFLSFFMIHLARHPELVAELRSDPLKLMRGAEEMFRRFPVVSEARMVAKDQEYKGVFL
KRGDMILLPTALHGLDDAANPEPWKLDFSRRSISHSTFGGGPHRCAGMHLARMEVIVT
LEEWLKRIPEFSFKEGETPIYHSGIVAAVENVPLVWPIAR

102 Family

CYP102A1   Bacillus megaterium
           Ruettinger,R.T.,Wen, L.-P. and Fulco, A.J. 
           Coding Nucleotide, 5'-Regulatory, and Deduced Amino Acid Sequences of 
           P450BM-3, a Single Peptide Cytochrome P450:NADPH-P450 Reductase from 
           Bacillus megaterium. 
           J. Biol. Chem. 264, 10987-10995 (1989)

CYP102A1    Bacillus megaterium
            GenEMBL J04832 (4957bp)
            Ravichandran,K.G., Boddupalli, S.S., Hasemann,C.A.,
            Peterson,J.A. and Deisenhofer,J. 
            Crystal structure of hemoprotein domain of P450BM-3, a prototype
            for microsomal P450s.
            Science 261, 731-736 (1993)
            P450 is N-terminal

CYP102A2    Bacillus subtilis
            GenEMBL D87979
            Yamamoto, H., S. Uchiyama, F. A. Nugroho, and J. Sekiguchi.
            A 23.4 kb segment at the 69 degrees-70 degrees region of the 
            Bacillus subtilis genome. 
            Microbiology. 143, 1317-20 (1997)
            Gene name yfnJ    66.4% identical to CYP102A1 P450 part only
            also called YetO (fusion of P450 and reductase like CYP102A1, P450 part is 
            N-terminal)

CYP102A3    Bacillus subtilis
            GenEMBL U93874, Z99117
            Sorokin, A., A. Bolotin, B. Purnelle, H. Hilbert, J. Lauber, A. 
            Dusterhoft, and S. D. Ehrlich.  
            Sequence of the Bacillus subtilis genome region in the vicinity of 
            the lev operon reveals two new extracytoplasmic function RNA 
            polymerase sigma factors SigV and SigZ. 
            Microbiology. 143, 2939-43 (1997)
            Gene name yrhJ  most similar to CYP102A2
            (fusion of P450 and reductase like CYP102A1 P450 part is N-
            terminal)

CYP102A4    Bacillus anthracis str. Ames
            GenPept AAP27014                
            bifunctional P-450:NADPH-P450 reductase 1 
            79% to 102A2
   1 MDKKVSAIPQ PKTYGPLGNL PLIDKDKPTL SFIKLAEEYG PIFRMQTLSD TIIVVSGHEL
  61 VAEVCDETRF DKSIEGALAK VRAFAGDGLF TSETQEPNWQ KAHNILMPTF SQRAMKDYHA
 121 MMVDIAVQLV QKWARLNPNE NVDVPEDMTR LTLDTIGLCG FNYRFNSFYR ETPHPFITSM
 181 TRALDEAMHQ LQRLDIEDKL MWRTKRQFQH DIQSMFSLVD NIIAERKSSE NQEENDLLSR
 241 MLNVQDPETG EKLDDENIRF QIITFLIAGH ETTSGLLSFA IYFLLKNPDK LKKAYEEVDR
 301 VLTDSTPTYQ QVMKLKYIRM ILNESLRLWP TAPAFSLYAK EDTVIGGKYP IKKGEDRISV
 361 LIPQLHRDKD AWGDNVEEFQ PERFEELDKV PHHAYKPFGN GQRACIGMQF ALHEATLVMG
 421 MLLQHFEFID YEEYQLDVKQ TLTLKPGDFK IRIVPRNQTI SHTTVLAPTE EKLKNHEIKQ
 481 QVQKTPSIIG ADNLSLLVLY GSDTGVAEGI ARELADTASL EGVQTEVAAL NDRIGSLPKE
 541 GAVLIVTSSY NGKPPSNAGQ FVQWLEELKG DELKGVQYAV FGCGDHNWAS TYQRIPRYID
 601 EQMAQKGATR FSTRGEADAS GDFEEQLEQW KQRMWSDAMK VFGLELNKNM EKERSTLSLQ
 661 FVSRLGGSPL ARTYEAVYAS ILENRELQSS SSERSTRHIE ISLPEGATYK EGDHLGVLPI
 721 NSEKNVNRIL KRFGLNGKDQ VILSASGRSV NHIPLDSPVR LYDLLSYSVE VQEAATRAQI
 781 REMVTFTACP PHKKELESLL EDGVYQEQIL KKRISMLDLL EKYEACEIRF EPFLELLPAL
 841 KPRYYSISSS PLVAQDRLSI TVGVVNAPAW SGEGTYEGVA SNYLAQRHNK DEIICFIRTP
 901 QSNFQLPENP ETPIIMVGPG TGIAPFRGFL QARRVQKQKG MNVGEAHLYF GCRHPEKDYL
 961 YRTELENDER DGLISLHTAF SRLEGQAKTY VQHVIKEDRI HLISLLDNGA HLYICGDGSK
1021 MAPDVEDTLC QAYQEIHEVS EQEARNWLDR LQEEGRYGKD VWAGI

CYP102A5    Bacillus cereus ATCC 14579
            GenPept AAP10153 
            NADPH-cytochrome P450 reductase/P450 fusion
            79% to 102A2 Bacillus subtilis
  1 MEKKVSAIPQ PKTYGPLGNL PLIDKDKPTL SFIKIAEEYG PIFQIQTLSD TIIVVSGHEL
  61 VAEVCDETRF DKSIEGALAK VRAFAGDGLF TSETHEPNWK KAHNILMPTF SQRAMKDYHA
 121 MMVDIAVQLV QKWARLNPNE NVDVPEDMTR LTLDTIGLCG FNYRFNSFYR ETPHPFITSM
 181 TRALDEAMHQ LQRLDIEDKL MWRTKRQFQH DIQSMFSLVD NIIAERKSSG DQEENDLLSR
 241 MLNVPDPETG EKLDDENIRF QIITFLIAGH ETTSGLLSFA IYFLLKNPDK LKKAYEEVDR
 301 VLTDPTPTYQ QVMKLKYMRM ILNESLRLWP TAPAFSLYAK EDTVIGGKYP IKKGEDRISV
 361 LIPQLHRDKD AWGDNVEEFQ PERFEELDKV PHHAYKPFGN GQRACIGMQF ALHEATLVMG
 421 MLLQHFELID YQNYQLDVKQ TLTLKPGDFK IRILPRKQTI SHPTVLAPTE DKLKNDEIKQ
 481 HVQKTPSIIG ADNLSLLVLY GSDTGVAEGI ARELADTASL EGVQTEVVAL NDRIGSLPKE
 541 GAVLIVTSSY NGKPPSNAGQ FVQWLEELKP DELKGVQYAV FGCGDHNWAS TYQRIPRYID
 601 EQMAQKGATR FSKRGEADAS GDFEEQLEQW KQNMWSDAMK AFGLELNKNM EKERSTLSLQ
 661 FVSRLGGSPL ARTYEAVYAS ILENRELQSS SSDRSTRHIE VSLPEGATYK EGDHLGVLPV
 721 NSEKNINRIL KRFGLNGKDQ VILSASGRSI NHIPLDSPVS LLALLSYSVE VQEAATRAQI
 781 REMVTFTACP PHKKELEALL EEGVYHEQIL KKRISMLDLL EKYEACEIRF ERFLELLPAL
 841 KPRYYSISSS PLVAHNRLSI TVGVVNAPAW SGEGTYEGVA SNYLAQRHNK DEIICFIRTP
 901 QSNFELPKDP ETPIIMVGPG TGIAPFRGFL QARRVQKQKG MNLGQAHLYF GCRHPEKDYL
 961 YRTELENDER DGLISLHTAF SRLEGHPKTY VQHLIKQDRI NLISLLDNGA HLYICGDGSK
1021 MAPDVEDTLC QAYQEIHEVS EQEARNWLDR VQDEGRYGKD VWAGI

CYP102A6    Bradyrhizobium japonicum USDA 110
            GenPept BAC48147                
            NC_004463 complete genome 3173438..3176674
            NADPH-cytochrome P450 reductase/P450 fusion
            54% to 102A2
   1 MSSKNRLDPI PQPPTKPVVG NMLSLDSAAP VQHLTRLAKE LGPIFWLDMM GSPIVVVSGH
  61 DLVDELSDEK RFDKTVRGAL RRVRAVGGDG LFTADTREPN WSKAHNILLQ PFGNRAMQSY
 121 HPSMVDIAEQ LVQKWERLNA DDEIDVVHDM TALTLDTIGL CGFDYRFNSF YRRDYHPFVE
 181 SLVRSLETIM MTRGLPFEQI WMQKRRKTLA EDVAFMNKMV DEIIAERRKS AEGIDDKKDM
 241 LAAMMTGVDR STGEQLDDVN IRYQINTFLI AGHETTSGLL SYTLYALLKH PDILKKAYDE
 301 VDRVFGPDVN AKPTYQQVTQ LTYITQILKE ALRLWPPAPA YGISPLADET IGGGKYKLRK
 361 GTFITILVTA LHRDPSVWGP NPDAFDPENF SREAEAKRPI NAWKPFGNGQ RACIGRGFAM
 421 HEAALALGMI LQRFKLIDHQ RYQMHLKETL TMKPEGFKIK VRPRADRERG AYGGPVAAVS
 481 SAPRAPRQPT ARPGHNTPML VLYGSNLGTA EELATRMADL AEINGFAVHL GALDEYVGKL
 541 PQEGGVLIIC ASYNGAPPDN ATQFVKWLGS DLPKDAFANV RYAVFGCGNS DWAATYQSVP
 601 RFIDEQLSGH GARAVYPRGE GDARSDLDGQ FQKWFPAAAQ VATKEFGIDW NFTRTAEDDP
 661 LYAIEPVAVT AVNTIVAQGG AVAMKVLVND ELQNKSGSNP SERSTRHIEV QLPSNITYRV
 721 GDHLSVVPRN DPTLVDSVAR RFGFLPADQI RLQVAEGRRA QLPVGEAVSV GRLLSEFVEL
 781 QQVATRKQIQ IMAEHTRCPV TKPKLLAFVG EEAEPAERYR TEILAMRKSV YDLLLEYPAC
 841 ELPFHVYLEM LSLLAPRYYS ISSSPSVDPA RCSITVGVVE GPAASGRGVY KGICSNYLAN
 901 RRASDAIYAT VRETKAGFRL PDDSSVPIIM IGPGTGLAPF RGFLQERAAR KAKGASLGPA
 961 MLFFGCRHPD QDFLYADELK ALAASGVTEL FTAFSRADGP KTYVQHVLAA QKDKVWPLIE
1021 QGAIIYVCGD GGQMEPDVKA ALVAIRHEKS GSDTATAARW IEEMGATNRY VLDVWAGG

CYP102B1    Streptomyces coelicolor cosmid F43.
            GenEMBL AL136502 CDS 10570..12153 gene="SCF43.12"
            Highly similar to the N-terminal P450 domain of Bacillus
            megaterium 41.9% identity in 497 aa overlap. 
            45% to 102A1 over 433 amino acids
            cloned and expressed by David Lamb and Steve Kelly

CYP102B2   Streptomyces avermitilis
           GenEMBL AP005050
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV7426 
           78% to 102B1 from Streptomyces coelicolor

CYP102C1    Rhodococcus sp. X309 
            GenEMBL AF059700.1 complement(3619-4584) runs off end of sequence
            partial gene 48% to 102B1 

CYP102D1   Streptomyces avermitilis
           GenEMBL AP005023
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV575 47% to 102A3 
           40% to 102B1, 44% to 102C1 partial seq 

CYP102E1    Ralstonia metallidurans
            GenEMBL NZ_AAAI01000371 
            104500-107000 region
            51% to 102D1
MSTATPAAALEPIPRDPGWPIFGNLFQITPGEVGQHLLARSRHHDGIFELDFAGKRVPFVS
SVALASELCDATRFRKIIGPPLSYLRDMAGDGLFTAHSDEPNWGCAHRILMPAFSQRAM
KAYFDVMLRVANRLVDKWDRQGPDADIAVADDMTRLTLDTIALAGFGYDFASFASDELDP 
FVMAMVGALGEAMQKLTRLPIQDRFMGRAHRQAAEDIAYMRNLVDDVIRQRRVSPTSGMD 
LLNLMLEARDPETDRRLDDANIRNQVITFLIAGHETTSGLLTFALYELLRNPGVLAQAY 
AEVDTVLPGDALPVYADLARMPVLDRVLKETLRLWPTAPAFAVAPFDDVVLGGRYRLRKD 
RRISVVLTALHRDPKVWANPERFDIDRFLPENEAKLPAHAYMPFGQGERACIGRQFALTE 
AKLALALMLRNFAFQDPHDYQFRLKETLTIKPDQFVLRVRRRRPHERFV
TRQASQAVADAAQTDVRGHGQAMTVLCASSLGTARELAEQIHAGAIAAGFDAKLADLDDA
VGVLPTSGLVVVVAATYNGRAPDSARKFEAMLDADDASGYRANGMRLALLGCGNSQWATY
QAFPRRVFDFFITAGAVPLLPRGEADGNGDFDQAAERWLAQLWQALQADGAGTGGLGVDV
QVRSMAAIRAETLPAGTQAFTVLSNDELVGDPSGLWDFSIEAPRTSTRDIRLQLPPGITY
RTGDHIAVWPQNDAQLVSELCERLDLDPDAQATISAPHGMGRGLPIDQALPVRQLLTHFI
ELQDVVSRQTLRALAQATRCPFTKQSIEQLASDDAEHGYA

CYP102F1   Actinosynnema pretiosum subsp. auranticum
           AF453501 complement(6501..9518)
           maytansinoid antitumor agent ansamitocin biosynthetic gene cluster I
           49% to 102A3
           gene = asm30
MVATGTRIPGPKPLPLVGNLLDVLTSDLDTDVDFLDRCHREHGG
IVALTFAGQRQVFASSHELVARMCSDPSWGKAVHPALEQVRDFAGDGLFTARGDEPNW
GKAHRLLMPAFGPTAMRDHFPAMLDIAEQMLVRWRRFGPDHRIDVADDMTRLTLDTIA
LCAFGARFNSFYRDRAHPFVDAMVRSLVEAGERAERLPGVQPFLVGRNQRYRDDIATM
NRIADGIVAARAALPAGERPDDLLERMLTCADPVTGERLSARNVRYQLATFLIAGHET
TSGLLSFAVHRLLAHPEVLRKAKDAVDGVLGDRVPAFEDLARLDYLGQVLRETLRLHP
TAPAFALAPDEPAELGGHAIGAGEPVLVMLPTLHRDPAVWRDPDVFDPERFAPERMDE
IPACAWMPFGHGARACIGRPFALQEATLVLALVLQRFDLALADPDHRLTIKQTLTLKP
DSLVVRARPRADRPGATATVETVVPHQVPATHRHGTPLHVFYGSNGGSGEGLARTIAG
DGAARGWATSVAPLDDAVRALPASGPVVIVSSSYNGAPPDNAAHFVRWLTQDGPDLSG
VDYLVLGCGNLDWSATYQRVPTLIDEAMAAAGARRLRERGATDARADFFGDWERWYEP
LWPLLSAECGVEVGEIGPRFRVVESDAADGLGDLASAVVLENRELVRGPDAGSKRHLE
LRLPDGTSYRTGDYLSVLPQNHPDLVRRAVARLGTRAERVVTVESSAPTGLVPVGRAL
RVDELLTRCVDLSAPAGAGVVARLAERCPCPPERAELAATTGATLLELLERFPSCAVD
LALALELLPAPRTRLYSISSAAEEQRAEVALTVSVTGVTSGYLSRVRPGDRVAVGIAS
PPESFRPPADNTVPVVLIAAGTGIAPFRGFLRARAALGGEPGPALLLFGCRGPELDDL
YAEEFAALGDWLEVDRAYSRHPDGEVRHVQHRLWQRRDRVRELVDAGARVYLCGDATR
VGPAVEEVLGRIGPGAGWLDALRAGGRYATDVF

103 Family

CYP103A1     Agrobacterium tumefaciens
             GenEMBL M19352, AF242881 CDS 141158.142426 
             gene="virH1"

CYP103A2     Agrobacterium tumefaciens
             GenEMBL AF034769
             GenEMBL AB016260 CDS 124584..125759

CYP103A3   Agrobacterium tumefaciens plasmid pTiAB2/73 vir region
           GenEMBL AF329849 892..2148
           gene = virH
           61% TO 103A1
MNARGPEKVSQTSGPIISASLDPDNVSVSDLDRSGHAIFAEWRP
KRPFLRRQDGVYVLLRADDVLGLSSDPRTRQIETELMLNRGINEGAVFDFVRYSMLFS
NNEVHSRRRSPFTRTFAFRMIENLRPQVSQLTETLFQDLKELDSFNFVEEFASKLPAV
AIAGLLGLPPSDIPYFTQLVYRVARCLSPSWRDADLPDIEASAAEFKNYVQAVIDDRR
SNPRDDFLSSFIRATREAEDLSPDEGLAQLMLIVLAGTDTTKTGLTALTGQLLRHRHV
WEALLKDESLVPAAVEEGLRFEPPVGSYPRLALADIDLEGFILPKGSLLALCTMSALR
DEKHFAHPELFDIHRKQMHWHMVFGAGAHRCLGEALARLELQEGLATVLRYAPTLSIE
GEWPTVQGHGGVRRIAEMRVGFRRQI

104 Family

CYP104A1     Agrobacterium tumefaciens
             GenEMBL M19352, AF242881 CDS 142447..143670 
             gene="virH2"

CYP104A2    Agrobacterium tumefaciens
            GenEMBL AB016260 
            103A2 CDS 124584..125759 and 
            104A2 CDS 125919..127094 83% to 104A1

105A Subfamily

CYP105A1    Streptomyces griseolus
            GenEMBL M36480 (1629bp) Y18556 CDS 2447..3703
            Omer,C.A., Lenstra,R., Litle,P.J., Dean,C.R., Tepperman,J.M.,
            Leto,K.J., Romesser,J.A. and O'Keefe,D.P.
            Genes for two herbicide-inducible cytochromes P-450 from
            Streptomyces griseolus
            J. Bacteriol. 172, 3335-3345 (1990)
            Gene suaC

CYP105A2    Amycolata autotrophica
            GenEMBL D26543 (1197bp)
            Kawauchi,H., Sasaki,J., Adachi,T., Hanada,K., Beppu,T. and 
            Horinouchi,S. 
            Cloning and nucleotide sequence of a bacterial cytochrome P-450 
            VD25
            gene encoding vitamin D-3 25-hydroxylase
            Biochim. Biophys. Acta 1219, 179-183 (1994)

CYP105A3    Streptomyces carbophilus
            GenEMBL D30815 PIR JC4287
            Watanabe,I., Nara,F. and Serizawa,N.
            Cloning, characterization and expression of the gene encoding
            cytochrome P-450sca-2 from Streptomyces carbophilus involved in
            production of pravastatin, a specific HMG-CoA reductase inhibitor
            Gene 163 (1), 81-85 (1995)

105B Subfamily

CYP105B1    Streptomyces griseolus
            GenEMBL M36481 (1688bp) M32239
            Omer,C.A., Lenstra,R., Litle,P.J., Dean,C.R., Tepperman,J.M.,
            Leto,K.J., Romesser,J.A. and O'Keefe,D.P.
            Genes for two herbicide-inducible cytochromes P-450 from
            Streptomyces griseolus
            J. Bacteriol. 172, 3335-3345 (1990)
            Gene subC, SU-2

CYP105B2    Streptomyces tubercidicus strain R-922 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Cyp229
            78% to 105B1

105C Subfamily

CYP105C1    Streptomyces sp.
            GenEMBL M31939 PIR S19629 (381 amino acids)
            Horii, M., Ishizaki, T., Paik, S.Y., Manome, T. and Murooka, Y.
            An operon containing the genes for cholesterol oxidase and a
            cytochrome P-450-like protein from a Streptomyces sp.
            J. Bacteriol. 172, 3644-3653 (1990)
            Gene choP

105D Subfamily

CYP105D1    Streptomyces griseus
            GenEMBL S45823 X63601 (1700bp) PIR S24750 (412 amino acids)
            Trower,M.K., Lenstra,R., Omer.C., Buchholz,S.E., and 
            Sariaslani,F.S.
            Cloning, nucleotide sequence determination and expression
            of the genes encoding cytochrome P-450soy (soyC) and 
            ferredoxinsoy (soyB) from streptomyces griseus.
            Mol. Microbiol. 6, 2125-2134 (1992)
            PIR S35901 (412 amino acids)
            Erratum. Cloning, nucleotide sequence determination and
            expression of the genes encoding cytochrome P-450(soy)
            (soyC) and ferredoxin(soy) (soyB) from Streptomyces griseus.
            Mol. Microbiol. 7, 1024-1025 (1993)

CYP105D2    Streptomyces griseus
            GenEMBL AF071145
            84% identical to 105D1

CYP105D3    Streptomyces sclerotialus
            GenEMBL AF071149
            68% identical to 105D1

CYP105D4    Streptomyces lividans 
            GenEMBL AF072709 CDS complement(1593..2813)
            69% to 105D1 67% to 105D2 82% to 105D3 57% to 105A1 

CYP105D5    Streptomyces coelicolor 
            3StF60 [Full Sequence] Sanger cosmid 
            CDS comp(2106-3344) 98% identical to CYP105D4
            cloned and expressed by David Lamb and Steve Kelly

CYP105D6   Streptomyces avermitilis
           GenEMBL AB070949.1 69121-70371
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV412_pteD 55% to 105D1 from Streptomyces griseus,
           53% to 105D4, 54% to 105D5 (if first 17aa left off 105D5)
           Gene = pteD

CYP105D7   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV7469 73% to 105D4 from Streptomyces lividans

CYP105D8    Streptomyces tubercidicus strain I-1529 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Cyp233
            68% to 105D7

CYP105D9   Streptomyces sp. JP95
           GenEMBL AF509565 11774..13024
           griseorhodin biosynthesis gene cluster
           55% to 105D6
           gene = grhO3
MTDTLDEPQTLADGAEDAPAYPVKRTCPYRMPPGYEELREKGPI
SRVTLWNGRTAWLVTGNDLGRRLFPDARLSSDVLDPRFPLLAPRIEAQRQQAAAPPLV
GVDDPVHARQRRMVLPSFGIRQINALRPEIQKYADDLLDTMLAKGPGVTVDLLTEYAL
PMPSAVICMLLGVPYEDHHYFDERSRHVLSSSGEEQAAQAQQAFTEILAYLDDLIVRK
QAEPGDTLLDELIARQLEEGKVDRQELAMIATVLLVSGHETTSNMIALSTMALLADPD
QLAALRADESLMPRAVDELMRFSSIGDMLMRVAKEDIEIEGHLIRAGDGVILSTMLMN
RDPGAFERPDELDIRRPAGRHVAFGYGIHQCIGQNLARAEMEIALATLFRRVPTLKLA
VPAEQVPVNAPFVLQGVSELPVTW

105E Subfamily

CYP105E1    Rhodococcus fascians
            GenEMBL Z29635 (7139bp) PIR S42052 (399 amino acids)
            Crespi,M., Vereecke,D.M., Temmerman,W.G., Van Montagu,M.
            and Desomer,J.
            The fas operon of Rhodococcus fascians encodes new genes required 
            for efficient fasciation of host plants.
            J. Bact. 176, 2492-2501 (1994)
MAGTADLPLEMRRNGLNPTEELAQVRDRDGVIPVGELYGAPAFL
VCRYEDVRRIFADSNRFSNAHTPMFAIPSGGDVIEDELAAMRAGNLIGLDPPDHTRLR
HILAAEFSVHRLSRLQPRIAEIVDSALDGLEQAGQPADLMDRYALPVSLLVLCELLGV
PYADRDELRDRTARLLDLSASAEQRAVAQREDRRYMATLVTRAQEQPGDDLLGILARK
IGDNLSTDELISIISLIMLGGHETTASMIGLSVLALLHHPEQAAMMIEDPNCVNSGIE
ELLRWLSVAHSQPPRMAVTEVQIAGVTIPAGSFVIPSLLAANRDSNLTDRPDDLDITR
GVAGHLAFGHGVHFCLGHSLARMTLRTAVPAVLRRFPDLALSPSHDVRLRSASIVLGL
EELQLTW

CYP105F1    Streptomyces lavendulae 
            GenEMBL AF127374 CDS 2006..3229
            48% to 105C1 42% to 105B1 40% to 105D1 new subfamily in 105

CYP105F2   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           85% to 105F1
           clone name SP8812

CYP105G1    Amycolatopsis mediterranei 
            GenEMBL AF040571 CDS complement(5011..6066)
            49% to 105C1, 105B1 new subfamily in 105 
            looks like an insertion in the seq from 80-120

CYP105H1    Streptomyces noursei ATCC 11455 nyst 
            GenEMBL AF263912 CDS comp (58637..59833)
            gene="nysN" 47% to 105B1 46% to 105A1 46% to 105D1 
            function="presumably involved in modification of the
            nystatin macrolactone ring"

CYP105H2    Streptomyces albus
            GenEMBL AF071143 
            77% to 105H1
LLIAGHETTANNIGLGVVTLLSHPQWAGDERAVEELLRLHSVAD
MVALRVAVDDVEIAGQVIRKGEGIVPLLAAANHDTEVFGCPHAFDPERSERRHVAFGY
GVHQCLGQNL

CYP105H3   Streptomyces natalensis 
           GenEMBL AJ278573 52789..53985
           pimaricin biosynthetic gene cluster.
           68% to 105H1
           gene = pimG
MTYTDPAAPETDPPAVDFPQRKPGVPFPPPDYADYRDRKGLVLS
QLSDGKRVWLVTRHEDVRAVLTSPSISSNPEHKGFPNVGNLGVPKQDQIPGWFVGMDS
PEHDRFRKALIPEFTVRRVRAMKPAIERTVDAQLDAMLAAGNTADLVADFALPIPSLV
ISALLGVPPADREFFESRTRVLVSLRSSTDDDRMAAAKDLLRYINRLVEIKQKWGGDD
LITRLLATGAIAPHEMSGVLMLLLIAGHETTANNIALGVVTLLANPQWIGDDRAVEET
LRFHSVADLVSLRVAVQDVEIAGQLIKAGEGIVPLVAAANHDENAFECPHAFDPSRSA
RHHVAFGYGVHQCLGQNLVRIEMEVAYRKLFERIPNLELAVPTDGLDIKYDGVLYGLN
ELPVRW

CYP105H4   Streptomyces nodosus 
           GenEMBL AF357202 complement(62051..63250)
           amphotericin biosynthetic gene cluster
           84% to 105H1
MTAETEMTTFAPGCPVAFPLRRPGRPFPPPEYADYRAGEGLVRS
ELPASGPVWLVTRHEDVRTVLTDPRISADPSRPGFPRARRTGGAPSQSEIPGWFVALD
PPEHDRFRKTLIPEFTVRKVRELRPAIQQIVDERIDALLAAGNSADLIADFALSVPSL
VISDLLGVPKADRDFFEAKTKVLVTLSSTDEQRDEASKALLRYLNRLIQIKGRRPGED
LISRLLQAGTMNRQELSGVSMLLLIAGHETTANNIGLGVVQLLTNPQWIGDDRIVEEM
LRYYSVADLVSFRVAVEDVEIGGQLIKAGEGIVPLIAAANHDGSVFDKPEEFNPERSA
RSHVAFGYGVHQCLGQNLVRVEMEIAYRTLFERIPTLELAVPVEELPLKYDGVLFGLH
ELPVTWS

CYP105H5   Streptomyces griseus 
           GenEMBL AJ300302 10678..11859
           Gene = canC
           72% to 105H3
MTTSPGPTVVDFPRRTPREPLPLSQYAEHRKQNGLVQTHLPNGR
PIWLVTRHEDVRAVLTHPRISANPDNEGFPNVGETMGVPKQEQIPGWFVGLDSPEHDR
FRKVLIPEFTVRRVRELRPAIERTVDERIDAMLAGGNTADLVNDFALPVPSLVISALL
GVPSADRDFFESRTRTLVAIRTSTDEERAEATRQLLRYINRLIVIKKKWRGEDLISRL
LSTGKLSDEELSGVLLLLLIAGHETTANNIGLGVVTLLSHREWIGDDRLVEELLRLHS
VADMVALRVAVDDVEIAGQTIRKGEGIVPLLASANHDTEAFGCPHAFNPERTERRHVA
FGYGVHQCLGQNLVRVEMEIAYRKLFERIPELRLAVPEDQLAYKYDGILFGLHELPVR
W

CYP105J1   Amycolatopsis mediterranei rifamycin 
           GenEMBL AF040570 CDS comp (67462..68673)
           52% to AF072709 105D4 50% to 105D1 new subfamily in 105

CYP105K1   Streptomyces tendae strain Tue901 
           GenEMBL Y18574 CDS 6325..7557
           45% to 105A3 46% to 105D1 43% to 105B1 new subfamily in 105
           gene="nikF"

CYP105K2   Streptomyces ansochromogenes
           GenEMBL AF469953  14..1246
           95% to 105K1
           note="involved in nikkomycin biosynthesis
MTEAFDHDIPSFPMARECPMHPPAEYRELRGQEPVSRVRMPDGQ
VAWLVLKHALARKLLADPRVSADRLHPAFPGRLTAEQRAATERVRRLTTRRSMIHLDG
DEHGAHRRILTGEFSLRRIAAQRPRVQEIVDRSIDEMLAAPQPADLVEHVSQAVPSLV
ICELLGVPHEQRRDFHEWAGMLVSRSVSIQERAAASDALNDFLEALVTEKERGEPADD
LIGRLIARNRQTPVMTHDEIVGTAVMLLVAGHQTTANMISLGVVALLENPEHKARIAA
DSSLLPPAIEEMLRYFSVVENAPARVATEDIAIGGVTIRKNEGIVVSGLAADWDDEVF
GHPDRLDFERGARHHVAFGYGVHQCLGQNLARVELEIVFETLLRRVPGLSLAVPAEEL
PYKDDAGIYGIYRVPVNC

CYP105L1    Streptomyces fradiae 
            GenEMBL AF055922 CDS comp (6507..7769)
              GenEMBL AF147703 complement(2565..3875)
            Fouces,R., Mellado,E., Diez,B. and Barredo,J.L.
            The left edge of the tylosin gene cluster from Streptomyces 
            fradiae
            Microbiology (1999) In press
            tylH1
            46% to 105A1 42% to 105D1 43% to 105B1 new subfamily in 105
MSSSGDARPSQKGILLPAARANDTDEAAGRRSIAWPVARTCPFS
PPEQYAALRAEEPIARAELWDGAPVWLISRQDHVRALLADPRVSIHPAKLPRLSPSDG
EAEASRSLLTLDPPDHGALRGHFIPEFGLRRVRDVRPSVEQIVTGLLDDLTARGDEAD
LLADFALPMATQVICRLLDIPYEDRDYFQERTEQATRPAAGEEALEALLELRDYLDRL
ISGKTGRESGDGMLGSMVAQARGGGLSHADVLDNAVLLLAAGHETTASMVTMSVLVLL
QHPTAWRELTVNPGLLPGAVDELLRYLSIADGLRRSATADIEIDGHTIRAGDGLVFLL
AAANRDEAVFSEPEAFDIHRSARRHVAFGYGPHQCLGQNLARMELEVALGAVLERLPA
LRPTTDVAGLRLKSDSAVFGVYELPVAW

CYP105L2   Micromonospora griseorubida
           GenEMBL AB089954 1490..2641
           gene cluster for the polyketide macrolide mycinamicin
           54% to 105L1
           gene = mycCI
MDRTCAWALPEQYAEFRQRATGWPAKVWDGSPTWLVSRYEHVRA
LLVDPRVTVDPTRQPRLSEADGDGDGFRSMLMLDPPEHTRLRRMFISAFSVRQVETMR
PEIEKIVDGILDRLLALEPPVDILTHLALPMSTQVICHLLGVPYEDREFFQERSELAS
RPNDDRSMPALIELVEYLDGLVRTKTAHPDTGLLGTAVTERLLKGEITHQELVNNAVL
LLAAGHETSANQVTLSVLTLLRHPETAAELREQPELMPNAVDELLRYHSIADGLRRAA
TADIVLGDHTIRAGDGLIILLSSANHDGNTFGAEATFDIHRPARHHVAFGYGPHQCLG
QNLARLEMEVTLGKLFRRVPALRLAQEPDALRVRQGSPIFGIDELLVEW

CYP105M1    Streptomyces clavuligerus clavulanic 
            GenEMBL AF200819 CDS 136..1359
            GenEMBL AY034175 CDS 200..1423
            GenEMBL U87786 CDS 13810..15036 
            function="involved in clavulanic acid biosynthesis"
            48% to 105B1 42% to 105A1 41% to 105D1 new subfamily in 105
MNEAAPQSDQVAPAYPMHRVCPVDPPPQLAGLRSQKAASRVTLW
DGSQVWLVTSHAGARAVLGDRRFTAVTSAPGFPMLTRTSQLVRANPESASFIRMDDPQ
HSRLRSMLTRDFLARRAEALRPAVRELLDEILGGLVKGERPVDLVAGLTIPVPSRVIT
LLFGAGDDRREFIEDRSAVLIDRGYTPEQVAKARDELDGYLRELVEERIENPGTDLIS
RLVIDQVRPGHLRVEEMVPMCRLLLVAGHGTTTSQASLSLLSLLTDPELAGRLTEDPA
LLPKAVEELLRFHSIVQNGLARAAVEDVQLDDVLIRAGEGVVLSLSAGNRDETVFPDP
DRVDVDRDARRHLAFGHGMHQCLGQWLARVELEEILAAVLRWMPGARLAVPFEELDFR
HEVSSYGLGALPVTW

CYP105N1    Streptomyces coelicolor 
            St4C2 [Full Sequence] Sanger cosmid 
            CDS 29986-31221 45% to 105A1 new subfamily in 105
            cloned and expressed by David Lamb and Steve Kelly

CYP105N2    Streptomyces glaucescens cytochrome P450
            GenEMBL AF071144
            95% to 105N1 only 5 aa diffs
            57% to AF071148 56% to AF071146 59% to 105D3 54% to 105A3 
LLIAGHETTTSMIALSTLLLLDRPELPAELRNDPDLMPAAVDEL
LRVLSVADSIPLRVAAEDIELSGRTVPADDGVIALLAGANHDPEQFDDPERVDFHRTD
NHHVAFGYGMHQCLGQNL

CYP107N3   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           91% to 107N1
           clone name SP0881

CYP105P1   Streptomyces avermitilis
           GenEMBL AB070949.1 67376-68575
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV413_pteC low 40% range to 105 subfamilies 
           Gene = pteC

CYP105P2   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           92% to 105P1
           clone name SP7863

CYP105Q1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV1611 49% to 105B1 from Streptomyces griseolus 
           46% to 105D4 and D5

CYP105Q2   Streptomyces sp. 
           GenEMBL BD133549
           78% to CYP105Q1 
  3 LIAGHETTATMISLGTLALFEHPDQLAVLRDTEDPKVVAGAVDELLRYLSIVHSGLRRVA 182
183 KGDIEIDGRLIRKGDGLLFDLQTANWDPNAFPGAERLDLARPARQHNAFGFGTHQC 350

CYP105Q3   Streptomyces sp.
           GenEMBL BD133546 
           77% to 105Q1
 139 MADTLTDAAPDTDGRVPEYPMPRATGCPLAPSPAAAELRGDRPITRVRIWNGSTPWLITR 318
 319 HADQRTLLTDPRVSNDDHEPDFPHVNAHRAAIAPHTPKLITNTDAPEHTRLRRSVNAPFL 498
 499 VKRIEAMRPAVQKIVDDLIDDMLAGPSPADLLTALALPVPSLVIAELLGVPYEDHHFFQE 678
 679 NSNRVLDNSLTAEEAQESSRALGGYLDTLFRTKLEQPGEDVLSEMGSKVKAGEMTHQEAV 858
 859 SMGVAMLIAGHETTATMISLGTLALFEHPDQLAVLRDTEDPKVVAGAVDELLRYLSIVHS 1038
1039 GLRRVAKGDIEIDGRLIRKGDGLLFDLQTANWDPNAFPGAERLDLARPARQHNAFGYGPH 1218
1219 QCLGQNLARLELQVVYGTLYRRVLTLRPAVPVDQLAFNHTGTTYGVKCLPVTW 1377

CYP105R1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV7186

CYP105S1    Streptomyces tubercidicus strain R-922
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Cyp230
            56% to CYP105S2

CYP105S2    Streptomyces tubercidicus strain I-1529
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Cyp234
            56% to CYP105S1

CYP105T1    Burkholderia fungorum
            GenEMBL NZ_AAAJ02000095 
            8366..9610 gene = Bcep2217
            44% to 105H1
MRKTMTSAINDVRPQTTSTFPFARTGSPLHPPAEYARYRDGQPV
TRVQMWDGRYAWIFTRMEDVKAVLSSPHFSVVPSKPGYPFLTPARAATVKSYQTFITM
DPPDHTRFRRMLTRDFTQKRMEELRPQIAAYVNRLIDEMLARGSPGDLVSALALKLPV
TVVSMLVGVPYEDHEDLVKWSGQRLDLEQNPTVSESAADNMLAYFDGLLQRKERDPGD
GADMLSRLVIEQIKPGHLSRLEAIHMVNLLYFAGHETTANQIALGTLSFLLDPRQRAL
LENNPGLLKNAIEEMLRFHTISHYNSCRVATADVEVGGTLIREGEGAYALIMAANRDP
AAFPAPDRFDIERPNSQEHVAFSYGLHMCLGQPLARLELQVCFEALFRRLPRLRLAVP
LEELPFKREMYVYGLHALPVTW

CYP105U1   Streptomyces hygroscopicus strain NRRL 3602
           AY179507 complement(63940..65133)
           Geldanamycin biosynthesis gene cluster
           50% to 105B1 52% to 105B2 not 105S
           gene = gdmP
MDEIRDYPESRAAACPFSPPLGYEELRERSAVTRVRMWDGSTPF
LVTGYHEARAALGDSRFSADGTHKAMPRFVKFEVPAEVFNLGRMDDPEHARIRRMLTA
NFTIRRTEAMRPMIQGIVDGLLDRLIAQGPPADLVADFAFPLPSQVIGVMLGVSDADF
AEFQQASQGVMDFTASAEEMGAALGVMVDYVARMCAAKRADPGDDLLSRLIVDQELTG
GLTQQQVVATALVLLLAGHETTANMIALSTVLLLSHPEQLARLRADAGLMGNAVDELL
RYITIVQEGTGRVATEDVEVGGVLIPGGEGVIINLPSANRDPHFADAHELDLSRPNAR
EHVAFGFGVHQCLGQTLARVELQIALETLLRRLPTLRLEVPFDDLAFLYESMNFGVAR
VPVAW

CYP105V1   Streptomyces sp. HK803
           GenEMBL AY354515 36297..37508
           Gene = plmT4 
           43% to CYP105Q1
MSQLSSELPAFPMSKAKGCPLDPPPEYAQLRSDRPVAKARLWDG
KEVWLITGYDEIRSIFTDPRISVDNTQPGYPWLSEQARTVVLTGGVKPVGRMDPPEHT
AMRRMLGQGFLVKKIQNMRGDVEALVNELIDDILAGPRPTDLVPSLAMPVPSTALGWV
LGVPPADKRLISLVPRLFDEDSGLEGAMEARAELFAYIDELITHRENQPGDDIISHLV
GYYQKGELSRVSVLTQSVTLIAAALDTTRSMITNGILALLQHPEQAAALIEDPDLVPA
AVEELLRYTVVTEFSSKRVAAADIEIAGETIKAGDGIICLISAGNRDEKVFTDPDTLD
VRRDAKQHLGFGAGIHTCIGKQLARMELEVVYGTLFRRIPELRLAVPFDQLVFRNTFD
VQGVRALPVTW

CYP105W1   Micromonospora echinospora
           GenEMBL AF497482 84045..85229
           Gene = calE10
           calicheamicin biosynthetic locus
           45% to CYP105K1 47% to 105D4
MPRRCPFGPPAEYARLRTERPVARLPMLGGNTAWVVSRYADVKR
VLSDPRMSADRRRAGFPRFAPTTESQRQASFANFRPPLNWMDPPEHTAARRQIVDEFA
ARRVRQLRPLVERVVDEHLDAMTAGRSSADLVPSFSYPVPSRVICEMLGVPYGEHAFF
ERRSTRMLSRGVPADERARCAREIREFLDGVVTDKERHPGDDVLSRLLAAQRAAGEPD
HEAVVSMAFVLLVAGHVTTSNMISLSVLALLTHPERLARLRAEPDRFPAAVEELLRYF
TIVEAATARTATADVTVGGVTIRAGEGVVALGQAANRDPAAFDRPDEFDPDRDARHHL
AFGYGRHICPGQHLARLELDVALSRLVRRLPGLRLTVDVDDLPLKEDGNIFGLHALPVAW

CYP105X1   Pseudonocardia autotrophica same as Amycolata autotrophica
           GenEMBL AF525299 2766..3974
           Gene = pauC
           P-450 gene cluster
           49% to 105A3
MAEDTLGQDFPMQRQCPFEPPKEYERLRAEQPISRVRMPDGTPA
WLVTLHEDVRTVLASPAFSSDLAHPGMPAVNPEIRTIARQQRPPFSRMDPPEHSFFRR
MLIPEFTVKRTKTLRAGIQSVVDGLIDDLLRKSPPVDLVDEFALPVPSLVICQLLGVP
YSRHEFFQQQARVILSRQSTREQVGAAFTALRAYLDTLVEEKLHTPGDDLTSRLATEH
LEPTGDVRRQDLVASCMLLLTAGHETTSHMISLGVTALLEHPDQLAALQNDLTLLPEA
VEELVRYLSIADYVPSRVALEDVVIGGTVIRAGEGVVPLLAAADWDPKVFDNPGTLDI
HRGNRRHACFGYGVHQCIGQHLARTELEVAFSTLFTRIPTLQIAAPSDELDYDHDGML
FGLHELPVTW

CYP105X2   Amycolata autotrophica same as Pseudonocardia autotrophica
           GenEMBL AF071148
           99% to 105X3 94% to 105X1 61% to 165B2
LLIAGHETTSHMISLGVTALLERPDQLAALQNDLTLLPEAVEEL
LRYLSIADYVPSRVALEDVVIGGTVIRAGEGVVPLLAAADWDPKVFDNPGTLDIHRGN
RRHVAFGYGVHQCLGQNL

CYP105X3   Micromonospora inyoensis 
           GenEMBL AF071146
           99% to 105X2 61% to 165B2 60% to 105A3
LLIAGHETTSHMISLGVTALLEHPDQLAALQNDLTLLPEAVEEL
LRYLSIADYVPSRVALEDVVIGGTVIRAGEGVVPLLAAADWDPKVFDNPGTLDIHRGN
RRHVAFGYGVHQCLGQNL

106 Family

CYP106A1    Bacillus megaterium 
            GenEMBL X16610
            Gene BM-1

CYP106A2    Bacillus megaterium
            GenEMBL Z21972 (4317bp) PIR S32216 (410 amino acids)
            PIR S39924 (410 amino acids) Swiss Q06069 (410 amino acids)
            Rauschenbach,R., Isernhagen,M., Noeske-Jungblut,C., Boidol,W.
            and Siewert,G.
            Cloning, sequencing and expression of the genes for cytochrome
            P450meg, the steroid-15beta-monooxygenase from Bacillus
            megaterium ATCC 13368.
            Molec. Gen. Genet. 241, 170-176 (1993)

CYP106B1    Bacillus anthracis str. Ames
            Genpept AAP26480                 
            47% to 106A2 47% to 109B1
  1 MASPENVILV HEISKLKTKE ELWNPYEWYQ FMRDNHPVHY DDEQDVWNVF LYDDVNRVLS
 61 DYSLFSSRRE RRQFAIPPLE TRININSTDP PEHRNVRSIV SKAFTPRSLE QWKPRIQSIA
121 NELVKDIENC SEVDIVEQFA APLPVTVISD LLGVPTTDRK KIKAWSDILF MPYSKEKFND
181 LDAEKGIALN EFKAYLLPIV QEKRYHLTDD IISDLIRAEY EGERLTDEEI VTFSLGLLAA
241 GNETTTNLII NSFYCFLVDS PATYKEVREK PKLISKAVEE VLRYRFPVTL ARRITEDTNI
301 FGPLMKKDQM VVAWVSAANL DEKKFSQASK FNIHRIGNEK HLTFGKGPHF CLGAPLARLE
361 AEIALTTFIN AFEKIALSPS FNIEQCILEN EQTLKFLPIR LKPQ

CYP106B2P  Bacillus cereus ATCC 14579
           GenPept AAP09572  GenEMBL AE017006
83% to 106B1 54% to CYP109B1 YjiB Z99110 Bacillus subtilis I -helix
1 MTSVITDGEI VTFSLGLLAA GNETTTNLII NSFYCFLVDS PGIYEELRKE PNLILKAIEE
61 VLRYRFPVTL TRRITALSER ESPSPLGMG

CYP106B3P  Bacillus cereus ATCC 14579
           GenPept AAP09575 GenEMBL AE017006
87% to 106B1 54% to 106A2 C-term fragment 
   LKEDTNIFGPF
 1 MKKNQMIVAW VSAANLDEKK FSQASQFNVH RTGNEKHLTF GKGPHFCLGA PLARLEAEIA
61 LTTFINAFEK IELFPSFCLE KCILENEQTL KYLPIRLKAT

107A Subfamily

CYP107A1    Saccharopolyspora erythraea
            GenEMBL X60379 Swiss Q00441 (406 amino acids)
            Haydock S.F., Dowson J.A., Dhillon N., Roberts G.A., Cortes J.,
            Leadlay P.F.
            Cloning and sequence analysis of genes involved in erythromycin 
            biosynthesis in Saccharopolyspora erythraea: sequence similarities 
            between eryG and a family of S-adenosylmethionine-dependent 
            methyltransferases.
            Mol. Gen. Genet. 230, 120-128 (1991).

            Weber J.M., Leung J.O., Swanson S.J., Idler K.B., Mcalpine J.B.
            An erythromycin derivative produced by targeted gene disruption in
            Saccharopolyspora erythraea.
            Science 252, 114-117 (1991)

CYP107A2   Streptomyces rochei plasmid pSLA2-L
           NC_004808 complement(44847..46067)
           64% to 107A1
           note="ORF26 (406 aa), lankamycin biosynthesis protein
           similar to M54983-1 Saccharopolyspora erythraea
           6-deoxyerythronolide B hydroxylase, EryF CYP107A1
MTTDAHTAVPSLDSDLFHIDQYEAYAALREREPVSKVSFIGREA
FLITRHAEAKAALGDLRLSNDFKKQPPGVELPTYHGIPEDVRPYFANNMGSNDPPAHT
RLRRLVSREFTARRVESMRTRVAQLAEHLLDGLAGERETDLVERFAYPLPITVISELL
GVEERYQGDFGRWSNEFLVIDADRVEQREHAARALVGFILELVDRRRADPGSDLLSAL
IHVHDEDEDRLSTDELASVVLILLIAGFETSVSLIAMATYLLLTHPGELAKVRADPSL
VPNAVDEVLRFLGPAEITTRGTLEPVEIGGVHIPAHSTVLIAGAAANRDPRRFPDPER
FDVTRDTGGHLSFGHGIHFCVGGPLARLEGEIALRALLNRFPGLDLAIPAEQVRWRRS
FLRGIESLPVRLGR

107B Subfamily

CYP107B1    Saccharopolyspora erythraea
            GenEMBL M83110 Swiss P33271 (405 amino acids) PIR B42606 (405 
            amino acids)
            Andersen J.F., Hutchinson C.R.
            Characterization of Saccharopolyspora erythraea cytochrome P-450 
            genes
            and enzymes, including 6-deoxyerythronolide B hydroxylase.
            J. Bacteriol. 174, 725-735 (1992)

CYP107B2   Streptomyces sp.
           GenEMBL BD133548 
           58% to 107B1
3   LIAGHETTTNFIGNAALALLRHPESLAHLRAEPQLLGGALDELLRYDSPVGIATFRFSTE 182
183 ALTLGGTEIPEGVPVLIAPGAANRDPDRFPDPDRLDLTRGATGHLAFGFGMHHC 344

107C Subfamily

CYP107C1    Streptomyces thermotolerans
            GenEMBL D30759 (3267bp complete sequence of CarA) 
            Arisawa,A., Kawamura,N., Takeda,K., Tsunekawa,N.,
            Okamura,K. and Okamoto,R.
            Cloning of a macrolide antibiotic biosynthesis gene acyA, which
            encodes 3-O-acyltransferase, from Streptomyces thermotolerans and 
            its use for direct fermentative production of a hybrid macrolide.
            Appl. Environ. Microbiol. 60, 2657-2660 (1994)

            Arisawa,A., Tsunekawa,N., Okamura,K. and Okamoto,R.
            Nucleotide sequence analysis of carbomycin biosynthetic genes
            including macrolide antibiotics 3-O-acyltransferase gene from
            Streptomyces thermotolerans.
            unpublished (1994)

CYP107C1    Streptomyces thermotolerans
            GenEMBL M80346 (2393bp C-terminal fragment of CarA)
            Schoner,B.E., Geistlich,M., Rosteck,P., Rao.R.N., Seno,E.,
            Reynolds,P., Cox,K., Burgett,S. and Hershberger,C.L. 
            Sequence similarity between macrolide resistance determinants and
            ATP binding transport proteins.
            Gene 115, 93-96 (1992)
            Note: P450 fragment called carX. is equivalent to C-terminal of CarA.

107D Subfamily

CYP107D1    Streptomyces antibioticus
            GenEMBL L37200 (1400bp)
            Rodriguez,A.M., Olano,C., Mendez,C., Hutchinson,C.R. and 
            Salas,J.A.
            A cytochrome P450-like gene possibly involved in oleandomycin 
            biosynthesis by Streptomycese antibioticus.
            unpublished (1994)

107E Subfamily

CYP107E1    Micromosospora griseorubida
            GenEMBL D16098 (2168bp)
            Inouye,M., Takada,Y., Muto,N., Horinouchi,S. and Beppu,T.
            Cloning and nucleotide sequences of a gene governing mycinamicinIV
            hydroxylation.
            unpublished (1993)

107F Subfamily

CYP107F1    Streptomyces griseus
            GenEMBL D45916 (2787bp) AB018074 CDS 341-1561
            Ueda,K. and Horinouchi,S.
            Cloning and Nucleotide Sequence of a Gene Involved in Redbrown
            Pigment Biosynthesis in S. griseus
            Unpublished (1995)

CYP107F2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV1171 55% to 107F1 
           this subfamily is on the outskirts of CYP107

107G Subfamily

CYP107G1   Streptomyces hygroscopicus
           GenEMBL X86780 (107379bp)
           complement (91764-92978)
           rapN

107H Subfamily

CYP107H1  Bacillus subtilis
          GenEMBL U51868 (10153bp) Z99119, AF008220
          coding region 7164-8351
          pimelic acid biosynthesis
          gene name bioI

107J Subfamily

CYP107J1  Bacillus subtilis
          GenEMBL Y11043 U93876, Z99117
          Belitsky, B. R., M. C. Gustafsson, A. L. Sonenshein, and C. Von
          Wachenfeldt. 
          An lrp-like gene of Bacillus subtilis involved in
          branched-chain amino acid transport. J Bacteriol. 179, 5448-57 
          (1997).
          gene name cypA 42.6% identical to 107B1
          also called yrdE

CYP107J2  Bacillus anthracis str. Ames 
           GenPept AAP26475
           58% to 107J1 cypA of Bacillus subtilis
  1 MAMKNKVGIR IEDGINLASA QFKEDAYEIY KESRKVQPVL FVNKTELGAE WLITRYEDAL
 61 PLLKDNRLKK DPANVFSQDT LNVFLTVDNS DYLTTHMLNS DPPNHNRLRS LVQKVFTPKM
121 IAQLEGRIQD IADDLLNEVE RKGSLNLVDD YSFPLPIIVI SEMLGIPKED QAKFRIWSHA
181 VIAYPETPEE IKETEKQLSE FITYLQYLVD MKRKEPKEDL VSALILAESE GHKLSARELY
241 SMIMLLIVAG HETTVNLITN TVLALLENPN QLQLLKENPK LIDAAIEEGL RYYSPVEVTT
301 SRWADEPFQI HDQTIEKGDM VVIALAAANR DETVFENPEV FDITRENNRH IAFGHGSHFC
361 LGAPLARLEA KIAITTLFER MPELQIKGNR EDIKWQGNYL MRSLEELPLT F

CYP107J3   Bacillus cereus ATCC 14579
           GenPept AAP09568            
           59% to 107J1 cypA Y11043 Bacillus subtilis
  1 MKNKVGLSIE DGINLASAQF KEDAYEIYKE SRKKQPILFV NQVEIGKEWL ITRYEDALPL
 61 LKDNRLKKDW TNVFSQDIKN MYLSVDNSDH LTTHMLNSDP PNHSRLRSLV QKAFTPKMIA
121 QLDGRIQRIA DDLISDIERK GTLNLVDDYS FPLPIIVISE MLGIPKEDQA KFRIWSHAVI
181 ASPETPEEIK ETEKQLSEFI TYLQYLVDIK RKEPKEDLVS ALILAESEGH KLSARELYSM
241 IMLLIVAGHE TTVNLITNTV LALLENPNQL QLLKDNPKLI DSAIEEGLRY YSPVEVTTAR
301 WAAEPFQIHH QTIQKGDMVI IALASANRDE TVFENPEIFD ITRENNRHIA FGHGSHFCLG
361 APLARLEAKI AITTLFNRMP ELQIKGNREE IKWQGNYLMR SLEELPLTF

CYP107J4P  Bacillus cereus ATCC 14579
           GenPept AAP09593                 
           46% to CYP107J3 in same genomic region
           47% to CYP107Y1 SAV2377 AP005030 Streptomyces avermitilis
           50% to 107H1
  1 MKEPQLQQHL EKFIQYIEAL VNEKRLNPDA DLISELVQTK EQEDKLSNNE LLSTIWLLII
 61 AGHETTVNLI SNGLLALLQH PEQMNLIREN PSLIPSAVDE LLRHSGPVMF ISRLASEDMT
121 IHGKRIPKGD LVLLSLTAAN IDPQKFTYPE TLNISREENN HLAFGAGIHH CLGAPLARLE
181 GQIALGTLLQ RLPNLRLAIK PDQLNYNHSK IRSLVNLPVV F

CYP107K1   Bacillus subtilis
           GenEMBL AL009126 Z99113 comp(76702-77832)
           polyketide hydroxylase pksS
           just over 41% identical to CYP107J1

CYP107L1   Streptomyces venezuelae 
           GenEMBL AF087022
           GenEMBL AF079139 CDS 122..1372
           pikC gene
           function="catalyzes the hydroxylation of YC-17 into
           methymycin and neomethymycin and narbomycin into
           pikromycin"
           51% to 107B1 47% to 107A1 44% to AF254925 42% to 107J1 
           41% to AL049754 new CYP107 subfamily

CYP107L2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV1987 60% to 107L1 from Streptomyces venezuelae

CYP107L3    Streptomyces tubercidicus strain I-1529
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name CypLA
            60% to CYP107L1 91% to 107L4

CYP107L4    Streptomyces tubercidicus strain R-922
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name CypLC
            61% to CYP107L1 91% to 107L3

CYP107L5   Streptomyces sp.
           GenEMBL BD133547 
           68% to 107L2 
3 LIAGHETTVNLITGAVHALLTHPGQLAQVRGDMSLVDAVVEETLRHEGPVENATFRFAAE 182
183 PLEIGGTVIPAGDPVLIGLAAADRDGARYPGPDRFDIHRDTRGHLAFGFGTHRC 344

CYP107L6   Streptomyces sp.
           GenEMBL BD133544 
           72% to 107L2
MGHEHVIDLGEYGPGFTENPHPVYAELRARGPVHRVRLPKHDAHHEAWLVVGYEEARAAL
ADPRLSKDGSTIGVTFLDEELIGKYLLIADPPQHTRLRGLIAREFTGRRVERLRPRVQEI
TDSLLDEMLPRGRADLVESFAYPLPLTVICELLGVPEIDRAAFRKLSTEAVAPTSGESEY
AAFVQLAAYLEELVEEKRCAPPADDLLSALIRTTDEDGDRLSPAELRGMAFILLIAGHET
TVNLITGAVHALLTHPGQLAQVRGDMSLVDAVVEETLRHEGPVENATFRFAAEPLEIGGT
VIPAGDPVLIGLAAADRDGARYPGPDRFDIHRDTRGHLAFGHGIHFCLGAPLARLEARVA
LRALLERCPGLTPDGAPGEWLPGMLIRGVRSLPVRW*

CYP107L7P   Streptomyces narbonensis
            GenEMBL AF521878  13901..14661
            desosamine biosynthetic gene cluster
            91% to 107L1
            gene= nbmL
            note= frameshift and deleltion generates premature 
            stop codon and truncated protein"
MSRTHQGTTASRPVLDLAALGQDFAADPYPTYARLRAEGPAHRV
RTPEGDEVWLVVGYDTARAVLADPRFSKDWRNSATPPTEAEAALSHNMLESDPRCGPT
(deletion)
ALRADLTLLDGAVEEMLRYGGPVESATYRFPVEPVDLDGTVLPAGETVLVVLAD
AHRTPERFPDPHRFDIRRDTAGHLAFGHGIHFCTGAPLARMEARIAVRALLERCPDLALD
VSPGELFWYPNPMIRGLESLPIRWRSGREAGRRVPVEPACRP*

CYP107L8   Streptomyces sp. HK803
           GenEMBL AY354515 complement(72672..73871)
           Gene = plmS2
           56% to CYP107L6
MVTVDLSAYGPGFFTDPYPYYARLREAGPVHEIVLADGDRFWLI
VGYDEARAALADPRLAKSLDPPSEDERHVLITDPPDHTRLRRLVSREFTARRVEAMRP
RVQEITDGLLDEMVAGRRRADLVPSLGSPLPITVLCELLGVPLADREDFRGWTERVLV
PAEPDTIAWWKSRGFAQAGMALTDYLKNMIEDKRRSTPTGDLISSLLRTTAEDNDRLS
AAELHSMVFILIVAGHETTANLITNGVRALLAHPEQLAALRTDPEGLIDQAVEEMLRY
DGPVETSTKRFTLEAVRYGATKIPPGETLLVSIAATGRDPAQFERPDTFDIHRGTTGT
RSGHVAFGHGIHFCLGAGLARMESRVAILTLLRRCPDLALDIDPAGLDWLPGIRVRGV
RSLPVRW

CYP107L9   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           62% to 107L6 before frameshift at C-term
           clone name SP0854

CYP107M1   Actinomadura hibisca 
           GenEMBL D87924CDS complement(6299..7534)
           45% to AF127374 CDS 3226..4458 44% to AF254925 
           45% to 107D1 44% to 107G1, 107E1 new subfamily in 107

CYP107N1   Streptomyces lavendulae 
           GenEMBL AF127374 CDS 3226..4458
           50% to 107D1 52% to AF254925 47% to 107E1 new subfamily in 107

CYP107P1   Streptomyces coelicolor cosmid H10 
           GenEMBL AL049754 CDS complement(10413..11648)
           41% to AF087022 40% to 107B1 40% tp 107G1 
           40% to 107D1 new subfamily in 107
           cloned and expressed by David Lamb and Steve Kelly

CYP107P2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV4539 86% to 107P1 from Streptomyces coelicolor

CYP107P3   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           78% to 107P2 missing 156 aa at N-term
           C-term may be frameshifted
           clone name SP0887

CYP107Q1   Amycolatopsis mediterranei 
           GeEMBL AF040571 CDS complement(781..>2316)
           66% to AF040570 comp(68704..69969) 43% to 107C1 
           41% to 107B1 40% to 107A1 new subfamily in 107

CYP107Q2   Amycolatopsis mediterranei 
           GenEMBL AF040570 CDS comp (68704..69969)
           66% to AF040571 complement(781..>2316) new subfamily in 107

CYP107R1   Streptomyces maritimus 
           GenEMBL AF254925 CDS comp (18384..19589) 
           gene="encR" 
           53% to AF127374 CDS 3226..4458 49% to 107E1 new subfamily in 107
MTTHTQQLRDFPFAPPAELHMEPAFAQLREEEPISRVRLPYGGE
AWLVTRYQDIKTVLGDPRFSRAATQHAQAPRIQPDPAGEGVLMSLDPPDHTRLRKTVA
GVFTKRRVEDLRPATQRIAEELLEAMEASGAPADLVASYALPLPVTVICDLLGVPGDD
REQLRGWSDALLSTTACTPAESAAAAQAMADHFAALVSQRRRQPTDDLLGALVQTWDR
EEGLLRDEELVLLTRDLLIAGHETTASQIANCTYLLLQRPHDMDRLRTDPSAMASAVE
ELLRFIPLGSGSFRARVATEPVELCGVRIQPGDTVFAPTVAANWDPDVFAEPGRLDID
RSPNPHVAFGHGVHHCLGAQLARLELQVALGVLLRRLPRLRLAVDEAEIVWKTGMQVR
GPKTLPVKW

CYP107S1   Pseudomonas aeruginosa
           NZ_AABQ07000001
           NC_002516 3741011..3742267
           locus_tag = PA3331
           47% to 107B1

CYP107T1   Streptomyces coelicolor  
           StH63 [Full Sequence] Sanger cosmid 
           51% to CYP107L1 CDS 16028-17233
           cloned and expressed by David Lamb and Steve Kelly

CYP107U1   Streptomyces coelicolor 
           StE41 [Full Sequence] Sanger cosmid 
           comp(7438-8739) 44% to CYP107B1 
           cloned and expressed by David Lamb and Steve Kelly

CYP107U2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3536 85% to 107U1 from Streptomyces coelicolor

CYP107U3   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           84% to 107U1 missing 90 aa at N-term
           clone name SP0819

CYP107V1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3519 low 40% range with some 107 subfamilies

CYP107W1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2894_olmB low 40% to 107 subfamilies

CYP107X1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV6249 49% to 107L1 from Streptomyces venezuelae

CYP107Y1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2377 50% to 107L1 from Streptomyces venezuelae

CYP107Z1    Streptomyces rimosus ssp. paromyceticus strain R-2374 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema11
            96% to CYP107Z2v1

CYP107Z2v1  Streptomyces albofaciens strain C-0083
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema8
            96% to 107Z2v2 and CYP107Z1

CYP107Z2v2  Streptomyces rimosus ssp. paromyceticus strain BOEH-4355
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema3
            96% to CYP107Z2v1 95% to CYP107Z1

CYP107Z3    Streptomyces sp. strain IHS-0435
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema7
            76% to 107Z12

CYP107Z4    Streptomyces lydicus strain NRAB-0114 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema16
            82% to 107Z12

CYP107Z5V1  Streptomyces lydicus strain NRRL-2433 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema15
            97% to 107Z5v3

CYP107Z5v2  Streptomyces chattanoogensis DSM-40241 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema6
            1 aa diff to CYP107Z5v3

CYP107Z5v3  Streptomyces lydicus strain R-401
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema4
            100% to S. kasugaensis strain A/96

CYP107Z5v3  Streptomyces kasugaensis strain A/96
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema10
            100% to S. lydicus strain R-401

CYP107Z6    Streptomyces sp. strain I-1525 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema5
            85% to CYP107Z8

CYP107Z7    Streptomyces tubercidicus strain DSM-40261 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema17
            90% to CYP107Z8

CYP107Z8    Streptomyces platensis strain Tu-3077 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema13
            89% to CYP107Z9

CYP107Z9    Streptomyces tubercidicus strain NRAA-7027 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema12
            89% to CYP107Z8

CYP107Z10   Streptomyces tubercidicus strain I-1529 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema2
            90% to CYP107Z11

CYP107Z10   Streptomyces platensis strain I-1548
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema14
            100% to S. tubercidicus strain I-1529

CYP107Z11   Streptomyces platensis strain NRAA-7479 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema9
            92% to 107Z12

CYP107Z12   Streptomyces tubercidicus strain R-922 
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name Ema1
            92% to CYP107Z11

CYP107AA1   Bradyrhizobium japonicum USDA 110
            GenPept BAC51802                 
            NC_004463 complete genome complement(7193424..7194725)
            41% to 133B1v1 45% to 107L1
  1 MVTPGSGAAI GVFVSCGNRF EVTMNEQAQP AGGDPLFNPL SPDFIRNPYP HYDRLRAIDP
 61 IHVTPFGQFV ASRHADVSLV MRDKRFGKDF VERSKRRYSE KIMDEPVFRS MSHWMLQADP
121 PDHTRLRGLV VKAFTARRVE DMRPRIQEIV DEAIDAVIDR GHMDLIEDFA FRLPVTIICD
181 MLGIPEDHRE VFYKSSRDGG RLLDPVPLTP EEIAKGNAGN MMAQMYFQQL FELRRRNPAD
241 DLTTQLVQAE EDGNKLTNEE LTANIILLFG AGHETTVNLI GNGLLALHRN PDQLALLKAR
301 PELMVNAIEE FLRYDSSVQM TGRVTLEDID DLGGRKIPKG ETVLCLLGSA NRDPAVYPDR
361 PDRLDVTRPN VKPLSFGGGI HFCLGAQLAR IEAEIAIATL LRRLPDLRID DVENPEWRPT
421 FVLRGLKSLP ASW

CYP107AB1   Streptomyces rochei plasmid pSLA2-L
            NC_004808 Links 87725..88939
            49% to 107A1 
            note="ORF37 lankamycin biosynthesis protein
MNQPQLPEIPALNSELFHTDQYATYREILEQRPVTRVRFYDGSL
VWLVNRHEDVRAALTDPRLSNDPMKQSDIDLSAATGIPADLIEYFQRNMFRSDEPDHG
RLRKLVTREFTVRRINALRPRIRQIADDLLEKFAATGGGDLVEALARPLPLTVMCELL
GVPEEDRADFQTWSQHIVESSPEFAERNAVSYRSLFECVRSLIRRRRDEPGDDLLSAL
VDLRDVADRLSENELISTVFLLLVAGIETTVNVLGTGTFLLLTHPGELARLRADGALL
GPAVEEMLRYMAPIEITSRHTLEPVEIGGVSIDAQSTVLINLAAANRDPARFEDPQSF
RVDRNDGGHLTFGHGIHYCLGAALARAEAEVTFEALLERFPDLRLAASASDLTWRHAF
MRGPVELPVSWG

CYP107AC1   Streptomyces atroolivaceus
            GenEMBL AF484556 60948..62147
            leinamycin biosynthetic gene cluster
            48% to 107N1
            gene = LnmA
MSATRRVHIYPFEGEVDGLEIHPKFAELRETDPLARVRLPYGGE
GWMVTRYDDVRAANSDPRFSRAQIGEDTPRTTPLARRSDTILSLDPPEHTRLRRLLSK
AFTARRMGAMQSWLEELFAGLLDGVERTGHPADIVRDLAQPFTIAVICRLLGVPYEDR
GRFQHWSEVIMSTTAYSKEEAVSADASIRAYLADLVSARRAAPHDDLLGVLVSARDDD
DRLTEDELITFGVTLLVAGHETSAHQLGNMVYALLTHEDQLSLLREQPELLPRAVEEL
LRFVPLGNGVGNARIALEDVELSGGTVRAGEGVVAAAVNANRDPRAFDDPDRLDITRE
KNPHLAFGHGAHYCLGAQLARMELRVAIGGLLERFPGLRLAVPADQVEWKTGGLFRGP
QRLPIAW

CYP107AD1   Streptomyces hygroscopicus
            GenEMBL AF521896 4248..5489
            ansamycin biosynthesis gene cluster
            43% to 107X1
            gene = gdnH
MSGRHFEQGERGTAMADTPEEELRILDPQSVAQELRKHGPPRQI
TMHGTTAWLVSRYEEVRDCLGHPGMSPAAAYAASQGQTNPVSGLFEDTVAGTNPPQHT
RLRRLLAKAFTVRRVESLRPRVQEITDTLLDRIAVDGRADLVSALAIPLPMQVICELL
GVPIADRTEFHQWADLMLTPPLDPDTAARSQDASAKLWTYMEDLAEARRKAPEDDLIS
DLMSAHEDDRLSHREVVATARMMLIAGYELTGSFISNAVFSLLSQPDQMELLRKDPEL
AGRGLEELLRHAGPGILIVRFANEDVEIGSVSIRAGDQVLLDMDAAHSDPAHFTDGER
LDLTRDSAVHLQFGHGIHYCIGAPLARVEGQIALESLVRRFPGLRLSVPAAEISHSKN
PFIRSLTALPVEFEAQQPVAG

CYP107AE1   Streptomyces sp.
            GenEMBL BD133545 
            50% to 107X1
VILLKSLAANGLTASSCFTVSPLPIRSASPSIAFLTSSSERDSGVRNDRPSDAQPAIARF
RFPTPPHPRNPTQPHPTPPRPSPTDDPLQAPTFFADPYPTYARLRDTAPVLKVPTGSGGG
GRHSYVVTGYAEAREAFTDPRLSKDTASFFAGRPSQRDLHPAVSRNMLATDPPQHARLRA
LVTKAFTTGAVARLRPYISSLVDELLDTWPTHGTVDLIADLAVPLPVTVICELLGVPDSD
RASVRTWSSDLFAAGDPQRIDAASHAVGDYMTALVAAKRTAPGDSLLDDLIAVRDGQDHL
SEDELVSLAVLLLVAGHETTTNFIGNAALALLRHPESLAHLRAEPQLLGGALDELLRYDS
PVGIATFRFSTEALTLGGTEIPEGVPVLIAPGAANRDPDRFPDPDRLDLTRGATGHLAFG
HGIHRCLGAPLARAEAELALHAVITRYPQAALATPPETLPWRHTRLTRGLASLPITLRDH
PK*

CYP107AF1   Streptomyces collinus DSM2012
            GenEMBL AF293355 24259..25518
            Gene = rubU
            rubrinomycin gene cluster
            52% to 107B1
MARTDAPQAAPPADLFTPAFHQNPHEALAGLRRTAPAVPVMTPN
GLRTWLVTGHEHARALLADPRLSKDMRVGRDLIPRNFVDPDKQREFLAESGERSQFPH
VLSVHMLDSDPPDHTRLRRLVGRAFTARRVESLRPRITELTDELLDAMARHERLDLME
ALAFPVPFTVICWLLGVPPDDRAAFRRWSNLLVSGAGTDEVREASASMITYLTELIEA
KRNEPADDMLTDLVHARDAGDQLSSDELISMAFLLLVAGHETTVNLIGNGALALLTHP
EVREQLAADESLWPGAVEEFLRYDGPVTNATWRFTTEPVEVGSVTIPEGEFVTISIGA
AGRDPDRYPDPDRLDITRAHSGSVAFGHGIHHCLGAPLARLEGRIVLSRLFARLPGLR
LAADPDELSWRSSLMMRGLEELPVFTA

CYP107AG1   Streptomyces atroolivaceus
            GenEMBL AF484556 complement(120436..121638)
            Gene = LnmZ
            leinamycin biosynthetic gene cluster
            49% to 107E1
MSTEVETEKPAPVAYPFTGSEGLELSQSYAKLFEDGDPIRVQLP
FGEPAWLVTRYDDARFVLTDRRFSRHLATQRDEPRMTPRAVPESILTMDPPDHTRLRT
LVSKAFTPRRIESKRAWIGELAAGLVADMKAGGAPAELVGSYALAIPVTVICELLGVP
EDDRTRLRGWCDAALSTGELTDEECVQSFMDLQKYFEDLVKERRAEPRDDLTSALIEA
RDAHDRLAEPELIGLCISILIGGFETTASEISSFVHVLQQRRELWTRLCADPEAIPAA
VEELLRFVPFAANGISPRYALEDMTVGGVLVREGEPVIVDTSAVNRDGLVFDNADEVV
IDRADNRHMVFGHGAHHCLGAHLARVELQEALKALVEGMPGLRLSGDVEWKADMIIRA
PRVMHVEW

CYP107AH1  Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           50% to 107L6 missing about 42 aa at N-term
           clone name SP0749

CYP107AJ1  Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           52% to 107B1 frameshifted C-term
           clone name SP0908

108 Family

CYP108A1    Pseudomonas spp.
            Swiss P33006 (428 amino acids) PIR S27653 A42971 (428 amino acids)
            Also found a PIR cross-reference to EMBL S39894 but could not 
            retrieve it
            Peterson J.A., Lu J.-Y., Geisselsoder J., Graham-Lorence S.,
            Carmona C., Witney F., Lorence M.C.
            Cytochrome P-450 terp: Isolation and purification of the protein 
            and sequencing of its operon.
            J. Biol. Chem. 267, 14193-14203 (1992)

CYP108A1    Pseudomonas spp.
            GenEMBL M91440 (6620bp)
            Hasemann,C.A., Ravichandran,K.G., Peterson,J.A. and
            Deisenhofer,J.
            Crystal structure and refinement of cytochrome P450terp at 2.3A
            resolution.
            J. Molec. Biol. 236, 1169-1185 (1994)

CYP108B1    Caulobacter crescentus CB15
            GenEMBL AE005918 GenPept AAK24465
            NC_002696 complete genome 2703947..2705221
            Complete genome sequence of Caulobacter crescentus
            Proc. Natl. Acad. Sci. U.S.A. 98 (7), 4136-4141 (2001)
            47% to CYP108A1
  1 MTISTDIANT IIDPKAYADG DRIDQAFAHL RREAPLAVAQ PDGFDPFWVV TRHADILEVE
 61 RQNELFHNGD RATVVTTIEP DKKVREMMGG SPHLVRSLVQ MDNPDHFAYR KITQGALLPQ
121 NLRALEARIR EIARGFVDRM AEHGDRCDFA RDVAFLYPLH VIMEVLGVPE SDEPRMLKLT
181 QELFGNADPD LNRTGKSVTD VGEGVDSIQS VVMDFMMYFN AITEDRRANP RDDLATLIAN
241 GKINGEPMGH LEAMSYYIIA ATAGHDTTSS TTAGALWALA ENPDQFAKVK ADPSLIPGLI
301 EESIRWVTPV KHFMRTATAD AELGGQKIAK GDWIMLSYPS GNRDEAVFED PFTFRVDRTP
361 NKHVAFGYGA HICLGQHLAR MEMRVLWEEL FARLDHVELD GAPTRMVANF VCGPKSVPIR
421 FKMH

CYP108C1    Saccharopolyspora spinosa strain NRRL 18395
            No accession number
            Istvan Molnar
            Syngenta Biotechnology, Inc.
            47% to CYP108B1 43% to CYP108A1

CYP108D1    Novosphingobium aromaticivorans
            GenEMBL NZ_AAAV01000137
            16805..18166 gene = Saro1710
            47% to 108B1 39% to 108C1 
MTNTSRLTKRRRPRRSDGKREGFMDSIPMVPAEVGRAVIDPKSY
GTWEPLLDRFDALRAEAPVAKVVAPDDEHEPFWLVSSFDGVMKASKDNATFLNNPKST
VFTLRVGEMMAKAITGGSPHLVESLVQMDAPKHPKLRRLTQDWFMPKNLARLDGEIRK
IANEAIDRMLGAGEEGDFMALVAAPYPLHVVMQILGVPPEDEPKMLFLTQQMFGGQDE
DMNKSGLKDLPPEQISQIVAGAVAEFERYFAGLAAERRRNPTDDVATVIANAVVDGEP
MSDRDTAGYYIITASAGHDTTSASSAGAALALARDPDLFARVKADRNLLPGIVEEAIR
WTTPVQHFMRTAATDTELCGQKIAAGDWLMLNYVAANHDPAQFPEPRKFDPTRPANRH
LAFGAGSHQCLGLHLARLEMRVLLDVLLDRVDSLELAGEPKRVNSTFVGGFKSLPMRW
KAA

CYP108E1    Ralstonia metallidurans
            GenEMBL NZ_AAAI01000348
            46192..47481 gene = Reut4024
            41% to 108B1 39% to 108A1 48% to 108C1 
MTIASDFDTELASHEIYSDPERMHEMFETLRREDPVHWTTAPGH
PPFWAVTKQADVIEVGKHPDVFIASPKSFLMNDVEQRVRIEETAATGGKLVRTMIHMD
DPDHKKYRGLTQSYFMPANIKRLESVIQERARALVGRLIEKGTSEFCSEIAVWYPLQI
VMTLLDVPESEHPYLLKLTQQFLAPKDPTLRRDGPDERGKGAVAKEYFAYFGKMLAER
RAAPLKEDLGSLIAHATVDGEPLPLMEAVSYYVILATAGHDTTSSSMCSGLYYLLTQP
GELDRLRARPELMPSAIEEMFRHGSPVKHFVRTATRDFELRGKKIQAGDEVALMYHSA
SFDEEVFDEPRSFRIDRGPNKHVAFGFGIHACLGQNLARASMRTFFTELLARTESIEV
VGKAEFIASNQVGGMKTLNIRVTPSKQSTTDRIEVAA

109 Family

CYP109A1    Bacillus subtilis
            GenEMBL M24523 (3187bp)
            Lewis,P.J. and Wake,R.G.
            DNA and protein sequence conservation at the replication terminus
            in Bacillus subtilis 168 and W23
            J. Bacteriol. 171, 1402-1408 (1989)

            Ahn,K. and Wake,R.G.
            A unique open reading frame adjacent to the replication terminus 
            of the Bacillus subtilis W23 chromosome compared with Bacillus
            subtilis 168
            unpublished (1990)

            Ahn,K.S. and Wake,R.G.
            Variations and coding features of the sequence spanning the
            replication terminus of Bacillus subtilis 168 and W23 chromosomes
            Gene 98, 107-112 (1991)

CYP109B1    Bacillus subtilis
            GenEMBL AF015825 Z99110  
            YjiB
            also similar to CYP106A, both 106 and 109 are close 
            together on a tree

110 Family

CYP110A1    Anabaena sp. (a cyanobacterium)
            Swiss P29980 (354 amino acids) GenEMBL M38044 (5933bp)
            GenEMBL U38537, M13161
            Lammers,P.J., McLaughlin,S., Papin,S., Trujillo-Provencio,C. and
            Ryncarz,A.J.II.
            Developmental rearrangement of cyanobacterial nif genes: 
            Nucleotide sequence, open reading frames, and cytochrome p-450 
            homology of the Anabaena sp. strain PCC 7120 nifD element
            J. Bacteriol. 172, 6981-6990 (1990)
            This sequence was later revised to give a complete P450 sequence 
            of 448 amino acids.

CYP110A1    Nostoc sp. PCC 7120 same as Anabaena sp. PCC 7120
            GenPept BAB73407, C37842 (this entry missing N-term)
            NC_003272 complete genome 1708114..1709493
            1 aa diff to M38044
  1 MLTQLPNPIS VPSWWQLINW IADPIGFQKK YSKKYGNIFS MQLAGIGSFV ILGEPQALQE
 61 IFTQDSRFDV GRGNTLAEPL IGRTSLMLMD GDRHRRERKL LMPPFHGERL QAYAQQICLI
121 TNQIASEWQI GQPFVARSAM QKLSLEVIIQ IVFGLADGER YQQIKPLFTD WLNMTDSPLR
181 SSMLFLKSLQ KDWGTWTPWG QMKHKQRSIY DLLQAEIEEK RTKENEQRGD VLSLMMAARD
241 ENGQAMTDEE LKDELLTILF AGHETTATTI AWAFYQILKN VNVQEKLQQE LDRLGANPNP
301 MEIAQLPYLT AVSQETLRMY PVLPTLFPRI TKSSINIAGY QLEPDTTLMA SIYLIHYRED
361 LYPNPQQFRP ERFIERQYSP SEYIPFGGGS RRCLGYALAL LEIKLVIATV LSNYQLALAE
421 DKPVNVQRRG FTLAPDGGVR VIMTGKKSLK FEQSSKIFN

CYP110A2    Anabaena variabilis (a cyanobacterium)
            GenEMBL U38478 (1743bp)
            Lammers, P.J. and Duran, S.
            possible alkane/fatty acid hydroxylase

CYP110B1   Nostoc sp. PCC 7120 Same as Anabaena
           GenPept BAB75445, AC2274 
           NC_003272 complete genome complement(4523158..4524546)
           45% to CYP110A2 53% to 110E1 49% to 110D1 47% to 110C1
  1 MHLPKGPQTP VFVQVLRWVF SPMSFLEDCA KRYGDIFSVK LAKDVPAIVF LSNPKDIQQI
 61 LTNDNNQLDS PGDWNDLFEP LLGKRSVITL SGAEHQRQRQ LLMPPFHGER MRGYSQVITD
121 VTEKVISQHQ IGQPFQVRSV TQAITLRVIM QAVFGLYEGS RAEKLQHLLS DLLEKSSSPF
181 SVALLYFPSL RRDFGPIKFW GEQVQIQQQA DELIYQEIQE RRENPDPSRT DILSLLMDAR
241 DADGQPMTDV ELRDELMTLL VAGHETTATA LAWAMYWIHK LPPVKARLLE ELDSLGDNPD
301 STTIFKLPYL NAVYSETLRI YPVAMLTFAR RVIETMALGG YELPPGTPVL GSIYLTHHRE
361 DLYPEPKKFK PERFLERQFS PYEYLPFGGG TRRCLGLAFA QWEMKLALAK ILTSYELELV
421 NNSVEVRPKR RGLVTGPHRP IEMVIKSQRQ ITSRILETTT VS

CYP110B2   Nostoc punctiforme
           NZ_AAAY02000005 GenPept ZP_00111619.1
           complement(58895..60277) gene = Npun6097
           75% TO 110B1
MKLPKGPQSPAVLQMLRWITSPMSFMETCAKRYGDMFTIRLDSK
SPPLIFVSKPEVLEQILTNDIKGLEAPGDTNLVFESLLGKHSVITISGAEHQRQRQLL
LPPFHGERMRSYSQIISDITEKVISQYQIGQPFNIRSVTQAITLRVIMQAVFGLDEGP
RAEKLQHCLAEMLEKGSSVLSAALLYFPALQRDFGPINFWGKQMRRQQAADKLIYEEI
RERQEQPDPSRTDILSLLMAARDEAGQPMTDEKLRDELMTLLVAGHETTATALAWAFY
WIQKIPTVRQKLLKELDSLGDNPDPSTIFKLPYLNAVCSETLRIYPVAMLTFARVVRT
PLSLGGYELEPGIGVIGSIYLTHHREDLYPEPKQFKPERFLERQFSPYEYLPFGGGAR
RCIGLAFAQLEMKLALAKILSTRELELVDNSEVRPKRRGLVTGQDRPIQMVVTSQRQV
KFPILQTATV

CYP110C1   Nostoc sp. PCC 7120 Same as Anabaena
           GenPept BAB76385, AF2391         
           NC_003272 complete genome 5587079..5588485
           48% to CYP110A2 49% to 110E1 47% to 110B1
  1 MKYQIQRPNP LKTHPFLQKL QWIADPVEYM KKASLQHPDM FTAEVIGFGD TVVFVSHPQG
 61 IQTLFANDRK KLVAVGEANR ILYPLVGNNS MFLLEGVKHK QRRQLLMPSF HGERMREYGH
121 LIRNITENLF SQLQQDVTFS ALTAMREISM QVILQAVFGF YEGERCQQFK HLLPIFLSEL
181 FQSPLASSIL FFPSLQKDLG NLTPWGRFVR QREKIDKLLY AEIAERRQEI NSDRIDILSL
241 LISARDETGD SMSDKELRDE LITLMISGHE TTGTAMAWSL YWILQTPEVF QRLIQELDSL
301 GDSPDPMSIF RLPYLTAVCN ETLRINPVAM LTLPRVVKEP IELLGNRLET STTVVGCIYL
361 THHREDLYPE SKLFKPERFL KREFSQYEFM PFGGGVRGCI GQALAMFEMK IVLATVLSRY
421 QLALADRKPE RPQRQGFTLT PTNGVKMLIT GQHKRQNYSM AASTTFNA


CYP110C2   Nostoc punctiforme
           GenPept ZP_00108280.1
           GenEMBL NZ_AAAY02000070 complement(34550..35941)
           gene = Npun2703
           60% to 110C1
  1 MQLPNILKSP SLLQKLHWVS DPIGYMENAA QEYPDIFTGK IVGFGDTVVF VNHPQAIQEI
 61 LTNDRKKFTA VGELNGILKP LLGDNSVLML ESDRHKRQRQ LVTPSFHGER MQAYGQLICN
121 VSKKIFNQLP LNKPFVARNL TKEISLQVIL QSIFGFYEGE KIQKLRQLLP LLLELFESPL
181 SSSLFLFSFL QQDLGAWSPW GNFLRVREKI DQFLYTEIAE CQQQADPERI DILSLLISCR
241 DEAGQPMTDQ ELRDQLITLI LAGYDTTATA MAWGLYWIHK QPLVCEKLLQ ELDTLGDSPD
301 PMSISRLPYL TAVCNETLRI HPVTMFSFPR VVQEPLELLG HSLEPGTILL PSIYLTHHRE
361 NLYPQSKQFK PERFIERQFS PYEFLPFGGG VRRCMGEALA LFEIKLALAT IVSHYHLALV
421 DQRPEQPQRR GFNLAPGSGV KMVMTDQRAR KESLINMTTT PLS

CYP110D1   Nostoc sp. PCC 7120 Same as Anabaena
           GenPept BAB76465, AF2401
           NC_003272 complete genome 5678382..5679743
           48% to CYP110A1 53% to 110E1, 49% to 110B1
  1 MTVTQNLPNG PRIPRLLRLF KFITQPIQYV EDFAKVYGDN FTIWGSGESY FVYFSHPQAL
 61 EQIFTNVSCF ESSGGGSPLL ELLLGKNSLI LLEGDRHQRQ RQLLTPPFHG ERMRAYGQTI
121 REITQQVTQA WQMGKPFNIR ASMQEITMRV ILRVVFGVDE GELFQELRQL LTTLLDFMGS
181 PLMSSTFFFS FTQKDYGAWS PWGRMVRLIK KIDQLIYALI AQRRAEFGEN RQDILSLLIS
241 ARYDDGQPMS DVELRDELMT MLVAGHETTA SALTWAFYWI DSVPEVREKL FQELDTLNDD
301 SEPSIIAKLP YLTAVCQETL RFYPIVLNAF FRRTKNPMEI MGYKLPKATL VVPSIYLAHH
361 REEVYPQSKQ FRPERFLEKQ FSPYEYLPFG GGNRRCIGLA FAQYEMKIVL ATILSQFQVS
421 RLSKRPVQPV RRGLTLAAPG GMKMVANKRM RNS

CYP110D2   Nostoc punctiforme
           NZ_AAAY02000028 GenPept ZP_00109203.1
           52704..54170 gene = Npun3650
           68% to 110D1
MNIPLSVTLSNMKSRNNKIQKPSNLQTPMTATYNLPDGPQMPRW
LRTIKFISQPVKYVDDFAKTYGDTFTIRSSRSDNHIVYFSQPQALEEIFTADSRHFEV
GRGNTGLRFLLGDRSFMLVDGDRHQRQRQLLAPPFHGERMRAYGEDIRKITQQVSHEW
KIGKPFNIRESMQEITLRVILRVVFGLNEGELFEELRRSLSDLLDFISSPIMSSAFFF
RFIQKDFGAWSPWGRILLQRQKVDLLIYTLLRERRAQTDQNRQDILSLMMAARYDDGQ
GMSDEELHDELMTLLVAGHETTASALTWAFYWIDHLPEVREKLLQELNTIGVNPDLSS
VAKLPYLTAVCQETLRIYPIAMTAFVRIVKTPITIMGYELREGTAIVPSIYLAHHREE
VYPQSKQFKPERFLERQYSPYEYLPFGGGNRRCIGMAFAQYEMKIVLATVLSEFQVSL
VNKRPVHPVRRGLTVATPAGMRMVATPQVKRANTPALV

CYP110D3   Trichodesmium erythraeum
           GenPept ZP_00074554.1 GenEMBL NZ_AABK02000068
           complement(10019..11407) gene = Tery3870
           54% to 110D1
MTLPDGPSLSPLQRRLRTWKFIFSPLSAIEERYSEYGDIFRTNT
NSLYPFIYFCNPKAIQQIFTADPDTFTSGSINGILKYFVGLNSLLLQDGDRHKRQRKL
LMPPFHGDRMRKYGDLIYNITSNVISQWKIEQPFPIRKSTQEISLKVILAAVFGLDQE
GKSYEKLRVLMSDLLDSMSSPLSSTFLFFNFLRKDWGPWSPWGRFLRKKQELHELIIA
EIQTAKKEGNHRDDILSLLLEARDEAGNAMSDEEIKDELLTMLFAGHETTASALAWAL
YWIDMIPSVGEKLMAELATIPSNSDQVAITKLPYLSAICQETLRIYPIAMNAFPRVVQ
KPIEIMGYQLEPGMVAIVPIYLTHHREDIYPEPKKFKPERFLERQFSPYEYLPFGGGS
RRCIGSAFALFEMKLVLATILSQWELKLLPNQRISPVRRGLTMAPPANMRMVVKPKKS
WQKVSQPILTSG

CYP110E1    Nostoc sp. PCC 7120 Same as Anabaena
            GenPept BAB76532, AI2409
            NC_003272 complete genome 5753083..5754450
            50% to CYP110A2 53% to CYP110B1 53% to 110D1
  1 MKLPDSPKIP KFMQLVQWIY QPLQLMEASA KAHGDSFTLW LTNKRPIVFL SNPQAIQELF
 61 TTPLEQLDAR GTAQVLQPLL GENSLLLLSG ETHQRQRKLL TPPFHGDRMR AYGDIITNIT
121 KEVISNWQLG KPFSVRDSMQ EITLRVILQA VFGLREGERY TQLQKRLCDI LDLSGSALRS
181 TLSFLPALQI DLGRWSPWGH FLRQREAIDQ LLYAEIQDRR DHPDPSRTDI LSLMMAARDE
241 NGEAMTDVEL RDELMTLLVA GHETTASALT WALYWIHKLP QVREKLLAEL DNFGDNGDVN
301 EITRLPYLTA VCQETLRIYP IAMVTIPRIT KTNLEIGGHQ FAPGTMLVGC IYLMHRRPDL
361 YPQPQEFKPE RFLEKQYSLY EYLPFGGSNR RCVGMAFALY EMKLILATVL ANVDLALVDN
421 YPVKPTRRGV TLAPSGGKWL IATAQHQKIK NPVEV

CYP110E2   Nostoc punctiforme
           NZ_AAAY02000088 GenPept ZP_00107327.1
           complement(18173..19567) gene = Npun1723
           58% TO 110E1 55% TO 110B1
MSLLKLPNGPQTHPWIQMYQWLTNPLEYMEACTKRYGDIFTLKL
GQNFAHQVFISNPQAIQQIFTTDPKQLDSGESAGIKAPLLGQQSLLALDGKPHQRQRK
LLTPPFHGERMLAYGELIREITEQVSSQWQVGETFAVLPSMQAISFQVILKAVFGLED
GPRYKKLNELLIKILNPKIPLLRTVLLIFPSMRQDLGAWSPWGKYLRLRQQIDQLIYA
QIQERKAQPNLSGTDILSLMMAARDEAGEPMTDLELRDELMTLLVAGHETTATSLSWA
LYWIHHRPQVREKLLQELDNLGEKPDPNAIFRLPYLNAVCSETLRLYPVAMSALNRLV
KSPLQIGEYNFEPGTILIPSIYLTHHREDLYPESKQFKPERFLERQFSPYEYLPFGGG
NRRCIGMAFALFEMKLVLATVLSRWQMELADSKPVRPVRKGLLFSPAGGVQMVVKGKR
LQNQPILQTSSSSV

CYP110E3   Trichodesmium erythraeum
           GenPept ZP_00072591.1
           GenEMBL NZ_AABK02000017 complement(<3..1016)
           53% to 110E1 missing C-terminal 121 aa (runs off end of clone)
  1 MIKLPGPKSP ALTQILQWTA KPIKFMEKCA REYGDTFEVK LNYPIVFISH PKAIEEIFKA
 61 NPKKFDCGSS NKLAQPLLGD YSLLLLDDIP HQRQRKLLMP PFHGKRMQAY GELICNVAQE
121 VASKWEIGQV FSMREFTAEI SLKVILQAVF GLYEGERYSK LEKLLGSLLE SLSSPLKTSM
181 LFFQFLQIDL GPWSPWGNFI KNREEIYELL CAEISERRQK LDPERSDILT MLLLARDEEG
241 EGMSDIELRD ELMTLLIAGH ETTATSLSWA FYWIHHQPEI YQKLSRELET FGDDLNPMTV
301 INLPYMNAVC SETLRIYPVV IIVSPRKTKL PITIMGQT

CYP110E4   Gloeobacter violaceus PCC 7421
           GenEMBL AP006578 complement(257348..258724) 
           gene = gll3063
           NC_005125 complete genome complement(3256348..3257724)
           locus_tag = gll3063
           71% to 110E5 55% to 110E1
MSLPPGPSSPSPFQLMQWIGCPTDYLHTTAARYGDPFTMRVGVF
PPLVMFSDPRAIQQLFTAEAGTFDAGASNVALRPTLGANSLLLLDGERHQQQRRLLTP
PFHGERMRAYGELIRQVTEEVIVRWQPGKPFLVRNAMQRISLAVILQAVFGLHDGTRL
VRLRQALGSMLDAMSSPLSMAMLLMLPEDFGPWSPRARLQAHLGAIDELLYAEIRERR
EHFDAGAGDILGLLLAARDEAGAAMGDAELRDELMTLLVAGHETTATAMAWALYWIHY
LPQVRERLLAELDSLGSDPDPEAIARLPYLGAVCSETLRIYPVALIASPRVARHTVRI
LERDYEAGTRLAAGIYLAHHRPETYPEPERFRPERFLERTFSPYEFVPFGGGSRRCIG
MAFALYEMKLVIATVLLERDLRLVQPRLLRPVRRGVTLAPPEGLYLVPTGERSASRLL
SRTSTAGQ

CYP110E5   Gloeobacter violaceus PCC 7421
           GenEMBL AP006578 complement(258800..260176) gene = gll3064
           NC_005125 complete genome complement(3257800..3259176)
           locus_tag = gll3064
           71% to 110E4 55% to 110E2
MSLPAGPASPPPLQLLQWIGRPTDYLERTARRYGDPFTMRLGLH
SPVTGVFFSSPEAFQQLFNTEPGLFDSGGANASSTFNLLFGTNSLILLDGERHQQQRR
LLTPPFHGERMRSYGELIRTLAEQVTARWNLGTPFQARRSMQRISLGVILKAVFGLHD
GTRYLRVCRLLGNLIDASASPLLFGLRLIFPQDAGPMSPMGQLKAQIDAIDELLYAEI
RERRERPDPRADDILSLLMAARDEAGQGMGDVELRDELMTLLVAGHETTATAMAWALY
WIHRLPQVRERLLAELDSLGSDPDPEAIARLPYLGAVCSETLRIYPVAMVAFARVPRR
PVRILDREYPAGTFLIPNIYLAHRRPEAYPDPERFRPERFLERTFSPYEFVPFGGGSR
RCIGVAFALYEMKLVLATVLSRVELRLADPRPRLPVRRGLTLAPPEDLHLIPTALRSG
HRDLLPAC

CYP110F1   Nostoc punctiforme
           NZ_AAAY02000005 GenPept ZP_00111618.1
           complement(57031..58407) gene = Npun6096
           48% TO 110E1 48% TO 110D1
MKILDSLTTPSLLQTLQLIAKPTKTLENYATKYGDIFTMRVMGL
KSPPIVFFSHPQAISDCFAVPAHKLDFKKATHVFKPLFGENSIVFKEARSHQQQRQLL
LPAFHGDNLKSYGQAICQIAEELTQSWTSGTNICIHKLMSKITLEIILQVVFGITHGV
RYQQLKEQLSALLEDVTKPWYSSLFFFPSLQKDLGAWSPWGIFLKRREQIDKLIYAEI
SERRWQNDAMRTDILSLLMSAHDVNGQQMTDEELRDQLVSLLLLGYETTSGVLAWIFY
LIHSHPEVKHRLMQELSTLDNLTNPEAITQLPYLTAVCQETLRIHPIALICTPRMLKE
PVEIMGHKFTSETVLVPCIHLAHRRTDTYPEPEQFRPERFLNQKFSPYEYLPFGGGYR
GCIGAAFSMYELKLVTAIILSRFELSLTDKRPAYPVRRGITIVPSGGVKMVVTKKAKF
KRQTILST

CYP110G1   Trichodesmium erythraeum
           GenPept ZP_00074734.1
           GenEMBL NZ_AABK02000081 complement(2404..3738)
           42% to 110C1
  1 MKQVCALKTP LWLQRFNYIT NPVSYWQKAY SSYKDAFYAQ GINFGKPLMV FYTPSAAKQI
 61 IENCQGDLTT TSFDSELTAI FGDSSFFILE GTNHKKMRKL LIPALHGKHI KTYGELICNL
121 VNNLIENLPF NQSFSALEIA QEISMQVMIK LLFGNYQQER YQKIKQLMIN MVSLFAANVF
181 GFPLFFKFLQ QDLGLVSPWG NFLQQRRKIQ QLIYQEIAER RNHPNQERTD ILSLLMTAQD
241 EKGNFLNDEE LLGQLLSLLF TGNESTAASI AWSWYEVYRN SKIKEKLLEE INNLGDSPEP
301 LSLFNLPYLS AVCNETLRKY PVTMFMIPRI VKNTTEINGY QLDKGMLVTV GTYILHHRED
361 IYDQPEEFKP ERFIEHRFSS FEFLPFGRGM RGCIGADIAL YQMKLTLATI ISHHRLELTN
421 YGQIFPKRRN TILTPIKLRI IKAC

111 Family

CYP111A1    Pseudomonas incognita
            GenEMBL L23310 (2080bp)
            Ropp,J.D., Gunsalus,I.C. and Sligar,S.G.
            Cloning and expression of a member of a new cytochrome P-450
            family: cytochrome P450lin (CYP111) from Pseudomonas incognita.
            J. Bact. 175, 6028-6037 (1993)

CYP111A2    Novosphingobium aromaticivorans
            GenEMBL NZ_AAAV01000134
            complement(20145..21356) gene = Saro1618
            65% to CYP111A1
MLDLKNPDTYQGGVPYAALQDLRAEGPVHWNPESDGAGFWAVLG
HDEIVAVSRQPDLFSSAFENGGHRIFNENQVGLTGAGESAIGIPFISRDPPSHTQYRK
FVMPALSPARLQGIEERIAKRVERLFAQVPLGETVNILPLLTVPLPLLTLAELLGVPA
DLWPDLHRWTDAFVGEDDPDFRQSPEAMQAVLAEFMGFATALFEDRRANPGPDIASLL
ANTEIRGEPAPLRDFIANLILALVGGNETTRNSINHTMIALAENPGQWDILRADPSLM
TAAVKEMVRFASPVIHMRRTAMRDTQLGQQAICKGDKVVIFYPAGNRDPAVFENPDRF
EITRPVRQHLAFGSGAHVCVGSRLAEMQLRLAFAEMARHVRAFEVVGEPSRVRSNFIN
GFKRLEVRLLV

112 Family

CYP112A1    Bradyrhizobium japonicum
            GenEMBL L02323 L12971 U12678 (11,715bp)
            NC_004463 complete genome 2317922..2319127
            Tully,R.E. and Keister,D.L.
            Cloning and mutagenesis of a cytochrome P-450 locus from
            Bradyrhizobium japonicum that is expressed anaerobically and
            symbiotically
            Appl. Environ. Microbiol. 59, 4136-4142 (1993)
            Note: called BJ-1 see CYP114, CYP115P, CYP117

CYP112A2    Rhizobium sp. NGR234 plasmid pNGR234a
            GenEMBL   AE000083 
            NC_000914 complement(233666..234868)
            Gene = y4lD
            Freiberg,C., Fellay,R., Bairoch,A., Broughton,W.J., Rosenthal,A.
            and Perret,X.
            Molecular basis of symbiosis between Rhizobium and legumes
            Nature 387 (6631), 394-401 (1997)
            about 92% identical to 112A1
MPEQPLPTLPMWRVDHIEPSPTMLALRANGPIHNVRFPRGHEGW
WVTGYDEAKAVLSDAAFRPAGMPPAAFTPDCVILGSPGWLVSHEGGEHARLRTIVAPA
FSDRRVKLLAQQVEAIAAQLFETLAAQPQPADLRRHLSFPLPAMVISALMGVLYEDHA
FFAGLSDEVMTHQHESGPRSASRLAWEELRAYIRGKMRDKRQDPGDNLLTDLLAAVDR
GEATEEEAIGLAAGMLVAGHESTVAQIEFGLLAMLRHPQQRERLVGNPSLVDKAVEEI
LRMYPPGAGWDGIMRYPRTDVTIAGVHIPAESKVLVGLPATSFDPRHFEDPEIFDIGR
DAKPHLAFSYGPHYCIGMALARLELKVVFGSIFQRFPALRLAVAPEELKLRKEIITGG
FEEFPVLW

CYP112A3v1  Mesorhizobium loti
            GenPept NP_106888                
            95% to 112A2 Rhizobium sp. NGR234
  1 MSEQPLPTLP MWRVDHIEPS PEMLALRANG PIHHVRFPSG HEGWWVTGYD EAKAALSDAA
 61 FRPAGMPPAA FTPDSVILGS PGWLVSHEGG EHARLRTIVA PAFSNRRVKV LAQQVEAIAA
121 QLFETLAAQP QPADLRRHLS FPLPAMVISA LMGVLYEDHA FFAGLSDEVM THQHESGPRS
181 ASRLAWEELR AYIRGKMWDK RQDPGDNLLT DLLAAVEQGN ATEEEAIGLA AGMLVAGHES
241 TVAQIEFGLL AMFRHPQQRE RLVGDPSLVD KAVEEILRMY PPGAGWDGIM RYPRTDVTIA
301 GVHIPAESKV LVGLPATSFD PRHFDDPEIF DIGRDENPHL TFSHGPHYCI GMALARLELK
361 VVVGSIFQRF PALRLAVAPE ELKLRKEIIT GGFEEFPVLW

CYP112A3v2  Mesorhizobium loti
            GenEMBL AL672112 complement(85404..86606)
            Strain R7A symbiosis island
            Gene = msi071
            2 DIFFS with CYP112A3v1

CYP112A4   Rhizobium etli symbiotic plasmid p42d
           NC_004041 55365..56645
           89% to 112A3
           gene = cpxP2
MSEQSLPTLPMWRVDHIEPSPEMLALRAKGPIHRVRLPSGHECW
WVTGYDEAKAVLSDAAFLPAGMPPADFTPDSVILGSPGWLVSHEGDEHARLRTIVAPA
FSNSRVKLLTQQVEAITVQLFDTLAVQPQPADLRRHLSFPLPAKVISALMGVPFEEHA
FFAGLSDEVMTHQHESGPRSASGLAWEELRAYIHGKIRGKRQDPGDNLLTDLLAAVDQ
GKATEEEAIGLAAGVLVAGHESTVAQIEFGLLAMFRHPQQRERLVRDPSLVDKAVEEI
LRMYSPGAGWDGIMRYPRTDVTIAGVHIPAESKVLVGLPATSFDPCHFKDPEVFDIGR
DANPHLAFSYGQHNCIGAALARLELKAIFGSIFQRFPALRLAVAPEELKLRKEIITGG
FEEMPVLWCGRPPASQSSHLAAPGAHRSDQPLDR

113A Subfamily

CYP113A1    Saccharopolyspora erythraea
            GenEMBL L05776 (1320bp) S51613 U82823 PIR B40634 (412 amino acids)
            Stassi,D.L., Donadio,S., Staver,M.J. and Katz,L.
            Identification of a Saccharopolyspora erythraea gene 
            required for the final hydroxylation step in erythromycin
            biosynthesis.
            J. Bact. 175, 182-189 (1993)
            eryK erythromycin C-12 hydroxylase
            Note: two different database entries have different start 
            codons.  Neither is ATG.

113B Subfamily

CYP113B1    Streptomyces fradiae
            GenEMBL U08223 (7082bp)
            Merson-Davies,L.A. and Cundliffe,E.
            Analysis of five tylosin biosynthestic genes from the tylIBA 
            region of the Streptomyces fradiae genome.
            unpublished (1994)

CYP113B2    Streptomyces caelestis 
cytochrome P-450 hydroxylase homolog (nidi)
GenEMBL AF016585 CDS complement(1-396) N-term only, 60% to 113B1
MVDSVTGPMELSKDANAKELLDWFSHNRTHHPVFWDEGRQAWQV
FRYDDYLTVSNHPEFFSSDFTEVAPTPPELEMILGPGTIGALDPPAHGPMRKLVSQAF
TPRRMAGQEQRIRVIAEELLDRVRGQKTIA

CYP113C1   Streptomyces virginiae
           GenEMBL AB072568 4994..6202
           46% to 113A1
           gene = visD
MAQQTPPAPPSMADGGKAMLAWLRTMRDEHPVHEDQYGVFHVYR
HSDVLAVTSDPAVFSSDLSRLRPDSSALSEEILSVIDPPLHRKLRSLVSQAFTLRTVA
DLEPRVTELAGRLLEKVEGSEFDLVGDFAYPLPVIVIAELLGVPAEDRELFRGWSDRM
LSMQVDDPLEIQFGDEAGEDYERLVKEPLKEMHAYLQRHVDARRETPGDDLLSRLVTA
EIAGERLTDRQIVEFGALLLMAGHVSTSMLLGNTVLCLEENPETAAALRADRALISGV
IEEVLRMRPPITVAARVTTGEVVVGGVTIPKDRMVMASLLSANHDERHIQDPEVFDPR
RSPNPQLAFGHGIHYCLGGPLARLEGRVALEMLLDRFEDIRVTPGAPYDFHREGLFVP
ARSPLTVRRG

114 Family

CYP114A1    Bradyrhizobium japonicum
            GenEMBL L02323 L12971 U12678 (11,715bp)
            NC_004463 complete genome 2319222..2320511
            Tully,R.E. and Keister,D.L.
            Cloning and mutagenesis of a cytochrome P-450 locus from
            Bradyrhizobium japonicum that is expressed anaerobically and
            symbiotically
            Appl. Environ. Microbiol. 59, 4136-4142 (1993)
            Note: called BJ-3 see CYP112, CYP115P, CYP117

CYP114A2    Rhizobium sp. NGR234 plasmid pNGR234.
            GenEMBL AE000082 CDS comp (9861..11264) gene = y4lC 
            NC_000914 complement(232170..233573)
            cytochrome P450 BJ-3 homolog" 90% to CYP114A1
MDMQETTTACADAFAELASPACIDDPYPFMRWLREHDPVHRAAS
GLFLLSRHADICWALKATGDAFRGPAPGELARYFPRAATSLSLNLLASTLAMKEPPTH
TRLRRLISRDFTMREIDNLRPSIARFVAARLDGMAPALERGEAVDLHRQFALALPMLV
FAELFGMPQDDMFGLAAGIGAILEGLSPHASDPQLAAADAASARMKAYFGDLIQRKCI
DPRHDIVATLVGAHDDDADTLSDAELISMLWGMLLGGFATTAATIDHAVLAMLAYPDQ
RHWLQGDAAGVEAFVEEVLRCDAPAMFSSIPRIAQSDIELSGVVIPKNADVRVLIAAG
NRDPDAFADPDRFDPARFYGTSPGMSTDGKIMLSFGHGIHFCLGAQLARVQLAESLPR
IQARFPTLTVAEQPTREPSAFLRTFRALPVRLHAQGDSPRLTSAFLNGQRGVEGGASF
EHGDGERRSATDRRAQP

CYP114A3v1  Mesorhizobium loti
            GenPept NP_106889          
            92% to 114A2
  1 MDVQETTAAC RDAFAELASP ACIQDPYTFM RWLREHDPVH RAASGLFLLS RHADIYWALK
 61 ATGDVFRGPA PGELARYFPR AETSLSLNLL ASTLAMKEPP THTRLRRLIS RDFTIRQIDN
121 LRPSIARIVA ARLDGMAPAL ERGEAVDLHW EFALAVPILV FAELFGMPQD DMFGLAAGIG
181 AILEGLSPHA SDPQLAEADA ASARVQAYFG DLIQRKRTDP RNDIVSMVVG AHDDDADTLS
241 DAELISMLWG MLLGGFATTA ATIDHAVLAM LAYPEQRHWL QGDAVGVKAF VEEVLRCDAP
301 AMFSSIPRIA QRDIELGGVV IPKNADVRVL IAAGNRDPDA FSDPDRFDPA RFYGTTPGMS
361 TDGKIMLSFG HGIHFCLGAQ LARVQLAESL PRIEARFPTL ALAEQPTREP SAFLRTFRAL
421 PVRLHAQGG

CYP114A3v2  Mesorhizobium loti
            GenEMBL AL672112 complement(84020..85309)
            Strain R7A symbiosis island
            Gene = msi070
            10 DIFFS with CYP114A3v1

CYP114A4   Rhizobium etli symbiotic plasmid p42d
           NC_004041 56651..58252
           90% to 114A3
           gene = cpxP3
MDVQDTTAACHDAFAELASPACIQDPYPFMRWLREHDPVHRAAS
GLFLLSRHADIYWAFKATGDAFRGPAPSELARYFPRAASSLSLNLLASTLAMKEPPTH
TRLRRLISRDFTVGQIDNLRPSIARIVAARLDGMAPALERGEAVDLHREFALALPMLV
FAELFGMPQDDVFELSAIVSAILEGLSPHASDPQLAAADVASARVKAYFGDLILRKRA
DPRRDIVSTLVGAHTDDADTLSDAELISMLWGMLLGGFATTAATIDHAVLAMLAYPEE
RHWLQGDAAGVEAFVEEVLRCEAPAMFSSIPRIAQRDIELHGVVIPKDADVRVLIAAG
NRDPDAFADPDRFDPVRFYGTRPGMSSDGKIMLSFGHGIHFCLGAQLARVQLAESLPQ
IQARFPTLALAEQPTREPSAFLRTFRALPVRLHAQAAAEVRVVVDQDLCGTTGQCVLT
LPGTFRQREPDGVAEVCMATVPQALHAAVRLAASQCPVAAIRVIESEAGDDHCTNPGP
TPSPADAERHAAKDLRNPGEHDGTI

115 Family

CYP115A1P   Bradyrhizobium japonicum
            GenEMBL L02323 L12971 U12678 (11,715bp see 1351-1578)
            NC_004463 complete genome 2317600..2317905
            Tully,R.E. and Keister,D.L.
            Cloning and mutagenesis of a cytochrome P-450 locus from
            Bradyrhizobium japonicum that is expressed anaerobically and
            symbiotically
            Appl. Environ. Microbiol. 59, 4136-4142 (1993)
            Note: called BJ-2 see CYP112, CYP114, CYP117
            Note: This gene fragment has a perfectly good P450 sequence 
            of 76 amino
            acids that includes the C-terminal up to a stop codon.
            This may be a fragment of another intact P450 that was 
            broken up or
            rearranged during cloning.  A pseudogene would be expected 
            to have lost
            integrity slowly and the whole gene should fade at about 
            the same rate.
            This fragment is good but no upstream region continues it.
GDADRFDVTRRHNPHLSFGQGPHFCLGAALARLELGCAFPAL
FVRLEHLALTIAAEDVVYMPSYVIRCPQRLPVTFRPSIA

CYP115A2v1  Mesorhizobium loti 
            GenPept NP_106680 88% to CYP115A1P 39% to 154C1 41% to 154A1 
  1 MPAAPTQLDR LSSAILRQGG MARVSLPGDV VTWAAARHQT LRQMLSDQRF NKDWRQWRAL
 61 QDGEIPEDHP LIGICKVDNM TTAHGADHRR LRGLLSSSFA PSRIALLAPR VEQCVDRLLA
121 EMAQRGGSAD LMSEFAAPLP TNVIAELFGL PDEQREEIVA LTYSLASTSA TAEEVRQTRQ
181 RIPEFFRRLI ALKRGQLGDD LASALIVARD KGELVSDTEL IDMLFMVLSA GFVTTAGVIG
241 NGVLALLTHP QQLHLVRSGQ VPWSQAIEEI LRWGTSAANL PFRYATQDVE IDGCLVRRGD
301 AVLMAFHAAN RDEKAFGPGA NRFDVTRRHN PHLSFGEGPH SCLGAALARL ELRCAFPPLF
361 GRLEDLALTI AAEDVVYMPS YVIRCPQRLP VSFRPSVA

CYP115A2v2  Mesorhizobium loti
            GenEMBL AL672113 41375..42607
            Strain R7A symbiosis island
            Gene = msi159
            10 DIFFS with CYP115A2v1

CYP115A3P   Rhizobium etli symbiotic plasmid p42d
            NC_004041 54883..55296
            70% to 115A1P 70% to 115A2
            gene = cpxP1 pseudogene C-terminal
ANSYGRPTYGDTDMFDFNRLQNPHLPLGQGPHLCLGAALARLELGSVFPPPFVRPEDLALAIAAE

116 Family

CYP116A1    Rhodococcus erythropolis
            GenEMBL U17130 (6458bp)
            Nagy,I., Schoofs,G., Compernolle,F., Proost,P., Vanderleyden,J. 
            And De Mot,R.
            Degradation of the thiocarbamate herbicide EPTC (S-ethyl
            dipropylcarbamothioate) and biosafening by Rhodococcus sp. NI86/21
            involve an inducible cytochrome P-450 system and aldehyde
            dehydrogenase.
            unpublished

CYP116B1    Ralstonia metallidurans
            GenEMBL NZ_AAAI01000322 
            25751..28093 gene = Reut3205
            52% to CYP116A1 with C-term. Extension
            extension may contain a reductase and a ferredoxin component
MPQTNAPASSGSCPIDHSALRAPNGCPISHQAAAFDPFEDGYQQ
DPPEYVRWSRAQEPVFYSPKLGYWVVTRYDDIKAIFRDNITFSPSIALEKITPTGEAA
NAVLASYGYAMNRTLVNEDEPAHMPRRRALMEPFTPAELAHHEPMVRKLTREYVDRFI
DTGRADLVDEMLWEVPLTVALHFLGVPEEDMDLLRQYSIAHTVNTWGRPKPEEQVAVA
HAVGNFWQLAGRILDKMREDPSGPGWMQYGLRKQRELPEVVTDSYLHSMMMAGIVAAH
ETTANASANAIKLLLQHPDVWREICEDPALIPNAVEECLRHNGSVAAWRRLVTRDTEV
GGMSLAAGSKLLIVTSSANHDEHHFADADLFDIHRDNASDQLTFGYGSHQCMGKNLAR
MEMQIFLEELTSRLPHMRLAGQRFTYVPNTSFRGPEHLWVEWDPARNPERTDPTVLAP
RDAVRIGEPTGGTTGRTLIVERVETAAQGVSRIRLVSPDGRALPRWSPGSHIDIECGH
TGISRQYSLCGDPADTSAFEIAVLREPESRGGSAWIHASLRAGDKLKVRGPRNHFRLD
ETCRRAIFIAGGIGVTPVSAMARRAKELGVDYTFHYCGRSRASMAMIDELRALHGDRV
RIHAADEGQRADLAQVLGAPDANTQIYACGPARMIEALEALCATWPEDSLRVEHFSSK
LGTLDPSREQPFAVELKDSGLTLEVPPDQTLLATLRAANIDVQSDCEEGLCGSCEVRV
LAGEIDHRDVVLTRGERDANNRMMACCSRAAKGGKIVLGL

CYP116B2   Rhodococcus sp. NCIMB 9784
           GenEMBL AF459424 
           66% to 116B1 over full fusion protein length
           extension may contain a reductase and a ferredoxin component
MSASVPASAPACPVDHAALAGGCPVSANAAAFDPFGSAYQTDPA
ESLRWSRDEEPVFYSPELGYWVVTRYEDVKAVFRDNILFSPAIALEKITPVSAEATAT
LARYDYAMARTLVNEDEPAHMPRRRALMDPFTPKELAHHEAMVRRLTREYVDRFVESG
KADLVDEMLWEVPLTVALHFLGVPEEDMATMRKYSIAHTVNTWGRPAPEEQVAVAEAV
GRFWQYAGTVLEKMRQDPSGHGWMPYGIRKQREMPDVVTDSYLHSMMMAGIVAAHETT
ANASANAFKLLLENRAVWEEICADPSLIPNAVEECLRHSGSVAAWRRVATADTRIGDV
DIPAGAKLLVVNASANHDERHFERPDEFDIRRPNSSDHLTFGYGSHQCMGKNLARMEM
QIFLEELTTRLPHMELVPDQEFTYLPNTSFRGPDHVWVQWDPQANPERTDPAVLHRHQ
PVTIGEPAARAVSRTVTVERLDRIADDVLRLVLRDAGGKTLPTWTPGAHIDLDLGALS
RQYSLCGAPDAPSYEIAVHLDPESRGGSRYIHEQLEVGSPLRMRGPRNHFALDPGAEH
YVFVAGGIGITPVLAMADHARARGWSYELHYCGRNRSGMAYLERVAGHGDRAALHVSE
EGTRIDLAALLAEPAPGVQIYACGPGRLLAGLEDASRNWPDGALHVEHFTSSLAALDP
DVEHAFDLELRDSGLTVRVEPTQTVLDALRANNIDVPSDCEEGLCGSCEVAVLDGEVD
HRDTVLTKAERAANRQMMTCCSRACGDRLALRL

117 Family

CYP117A1    Bradyrhizobium japonicum
            GenEMBL L02323 L12971 U12678 (11,715bp)
            NC_004463 complete genome 2321653..2322996
            Tully,R.E. and Keister,D.L.
            Cloning and mutagenesis of a cytochrome P-450 locus from
            Bradyrhizobium japonicum that is expressed anaerobically and
            symbiotically
            Appl. Environ. Microbiol. 59, 4136-4142 (1993)
            Note: called BJ-4 see CYP112, CYP114, CYP115P

CYP117A2    Rhizobium sp. NGR234 plasmid pNGR234a
            GenEMBL   AE000082 complement(7357..8700) U00090
            NC_000914 complement(229666..231009) gene = y4kV
            Freiberg,C., Fellay,R., Bairoch,A., Broughton,W.J., Rosenthal,A.
            and Perret,X.
            Molecular basis of symbiosis between Rhizobium and legumes
            Nature 387 (6631), 394-401 (1997)
            about 90% identical to 117A1
MNVLLNPLNRRHRLRYDIPVMPGAFPLVGHLPAIVCDLPRLLRR
AERTLGSHFWLDFGPAGHLMTCVDPHAFALLRHKDVSSALIEEIAPELLGGTLVAQDG
GAHRQARDAIKAAFLPEGLTQAGIGDLFAPVIRARVQAWRDRGDVTILPETGDLMLKL
IFTLMGVPAQDLPGWHRKYRQLLQLIVAPSVDLPGLPLRRGRAARDWIDAQLRQFVRD
ARAHAARTGLINDMVSAFDRSDDALSDDLLVANIRLLLLAGHDTTASTMAWMVIELAR
QPMLWDALVEEAQRVGAVPTRHADLEQCPVAEALFRETLRVHPATTLLPRRALQELQL
GQRRIPAGTHLCIPLLHFSTSALLHEAPDQFRLARWLQRTEPIRPVDMLQFGTGPHVC
IGYHLVWLELVQFSIALALTMHKAGVRPLLLSGVEKGRRYYPTAHPSMTIRIGFS

CYP117A3    Mesorhizobium loti
            GenPept NP_106891
            NC_002678 complete genome 5191629..5192972
            locus_tag = mlr6367
            94% to 117A2
  1 MDMLLNPLDR RHRLRDDIPV VPGAFPLVGH LPAIVCDLPR LLRRAERTLG SHFWLDFGPA
 61 GHLMTCVDPD AFALLRHKDV SSALIEEIAP ELLGGTLVAQ DGGAHRQARD AIKAAFLPKG
121 LTQAGIGNLF APVIQARVQA WRDRGDVTIL RETGDLMLKL IFSLMGIPAQ DLPGWHRKYR
181 QLLQLIVAPP VDLPGLPLRR GRAARDWIDA QLRQFVRDAR AHAARTGLIN DMVSSFDRGD
241 DALSDDVLVA NIRLLLLAGH DTTASTMAWM VIELARQPGL WDALVEEAQR VGAVPTRHAD
301 LAQCPVAEAL FRETLRVHPA TTLLPRRALQ ELQLGQRRIP AGTPLCIPLL HFSTSALLHE
361 APDQFRLARW LQRTEPIRPV DMLQFGTGPH VCIGYHLVWL EMVQFCIALA LTMHKAGVRP
421 RLLSAVEKGR RYFPTAHPSM KIRIGFS

CYP117A3v2  Mesorhizobium loti
            GenEMBL AL672112 complement(81551..82888)
            Strain R7A symbiosis island
            Gene = msi068
            2 DIFFS with CYP117A3v1

CYP117A4   Rhizobium etli symbiotic plasmid p42d
           NC_004041 59081..60424
           85% to 117A2
           gene = cpxP4
MDMLLNPLNRWRRLRDDIPVMPGAFPLVGHLPAIVCDLPRLLRR
AERTLGSHFWLDFGPAGHLMTCLDPDALALLRHKEVSSALIEEMAPDILGGTLVTLDG
SAHRQARDGIKAAFLPRGLTEAGIGELFEPIIRAQVKAWRDRGEVAILPDTRNLMLKL
TFSLMGIPAQDLSEWHRKYRQLLQLMVAPPIDLPGMPLRRGRAARDWIDAQSRQFIRD
ARARAARTGLINDMVSAFDCSDGALSDDVLVANIRLLLLAGHETSASTIAWMVIELAQ
HPELWDALVEEAQRVGAVPTGHEDLAQCPVAEALFRETLRMHPASSLVPRRAMQELQL
GQRRIPSGTHLCIPLLHFSTSPLLHEAPDQFRLGRWLQRTEPIRPVDMLQFGAGPHVC
MGYHLVWLELVQFSIALALTMQEAGVRPRLMSGVEKGRRYYPTAHPSMTVRIGFS

118 Family

CYP118P1    Mycobacterium leprae
            GenEMBL L04666 (40,123bp)
            Smith,D.R.
            M. leprae cosmid dna sequence
            Unpublished (1992)
            Note 15,700 to 17,350 is the region of interest

CYP118P1    Mycobacterium leprae
            GenPept CAC31116                 
            NC_002677 547312..547788 locus_tag = ML0447
            NC_002677 complement(2562932..2563627) locus_tag = ML2159 
            (a duplication of the seq.)
            putative fatty oxidation complex alpha subunit 
            Sequence below is from TIGR primary nucleotide sequence for ML2159
            CYP118 exact match, 49% to 102C1
  4 TASQHDDILDIMLYSADPSTGEQLDTDNVVNQILTLLVSGSQTLANAIAFALHYLLSIHH 183
184 DIAAQTRREIYQNRSDRGIANVSY
258 FGDVVKLRCLRRVVDATLRLWS
    VPCYLRQARRD 360
361 TTLGNGTSLFHKGQWVIVLLTAPMPG
    WGPDANEFNPDRXXXXXXXXXXXXXXXX 470
520 FGTGLRTCIGRRFALHEMALELTMIVHQYILSRADPG 
    YCLSISEAFTLKTVGL 677

119 Family

CYP119A1   Sulfolobus solfataricus (an archaebacterium)
           GenEMBL U51337 (1254bp)
           Wright, R.L., Harris, K., Solow, B., White, R.H. and Kennelly, P.J.
           Cloning of a potential cytochrome P450 from the Archaeon Sulfolobus 
           solfataricus.
           FEBS. Lett. 384, 235-239 (1996)

CYP119A2   Sulfolobus tokodaii
           GenPept BAB66184                 
           64% to CYP119A1 U51337 Sulfolobus solfataricus
  1 MYDWFKQMRK ESPVYYDGKV WNLFKYEDCK MVLNDHKRFS SNLTGYNDKL EMLRSGKVFF
 61 DIPTRYTMLT SDPPLHDELR NLTADAFNPS NLPVDFVREV TVKLLSELDE EFDVIESFAI
121 PLPILVISKM LGINPDVKKV KDWSDLVALR LGRADEIFSI GRKYLELISF SKKELDSRKG
181 KEIVDLTGKI ANSNLSELEK EGYFILLMIA GNETTTNLIG NAIEDFTLYN SWDYVREKGA
241 LKAVEEALRF SPPVMRTIRV TKEKVKIRDQ VIDEGELVRV WIASANRDEE VFKDPDSFIP
301 DRTPNPHLSF GSGIHLCLGA PLARLEARIA LEEFAKKFRV KEIVKKEKID NEVLNGYRKL
361 VVRVERA

120 Family

CYP120A1    Synechocystis sp. (strain PCC6803) Cyanobacterium
            GenEMBL   D64003(113064bp)
            coding region 62160-63494
            Kaneko,T., Tanaka,A., Sato,S., Kotani,H., Sazuka,T., Miyajima,N.,
            Sugiura,M. and Tabata,S.
            Sequence analysis of the genome of the unicellular cyanobacterium
            Synechocystis sp. strain PCC6803. I. sequence features in the 1Mb
            region from map positions 64% to 92% of the genome
            DNA Res. 2,153-166 (1995)
            note: gene slr0574 (previously had incorrect gene identifier here)

NT01NS3472 Nostoc sp. PCC 7120 in TIGR not in Genbank
40% to CYP120 aa 399-443
MEMKIVAAHLLRRYHWEILPNQSLDSVLVPTNQPQDGLRVRFQPL

CYP120A2   Trichodesmium erythraeum
           NZ_AABK02000021 
           complement(1844..2800) gene = Tery2088
           318aa (short) 57% to 120A1 (missing N-term 127aa)
MTANYLEKWVEMGTLTWYPEIRNYTFDIASLLFMGSDESSQTKL
VSLFEEWVKGLFSIPLSLPWTRFGKSLRCRQKLLQHIEEIILQRQQQQNLGEDALGIL
LQAQDKEVNGLSLDELKDQILLLLFAGHETLTSAIASFCLLTSQHLDVLTRLRQEQKQ
FSAIEPLTLENLKRMTYLDMVLKEVLRLIPPVGGGFRQVTQDCEFCGYSIPKGWLVQY
QIAKTHQDETLYPDDKNFDPERFAPENAVDKQKVFGYVPFGGGMRECLGKEFARLEMK
IFAVMLLRGYEWELLPEQDLSVVAAPTPYPRDGLKVKFRKVE

CYP120B1   Nostoc punctiforme
           NZ_AAAY02000018.1 
           complement(62382..63695) gene = Npun4299
           43% TO CYP120A1
MKTNQIPPGSFGLPVLGETLSFVFDRDFAKKRYHQYGPIFKTHL
LGRPTVVMAGPEALEFVLSSHIENFSWREGWPDNFKTLLGESLFLQDGEEHRRNRRLM
MPALHGPALASYFSTMEDITRSYLQKWEKKQEFTWFQEFKQLTFDIASQLFLGTRPGP
ECVRLSQLFTTLTNGLLAINPLPLPFTTFGKAIAARNEILEHLTQVVRERQQNPTQDT
ISLLIKAKDEDGNSLSEKEIIAQAVLLLFAGHETTTSMLTWLCTELACHPEVLEKARV
EQLQLASQGDLDLEQLGKMPYLEQVLWEVERLHQPVGGGFRGVIKDFELNGYHVPTGW
QLYYSIGVTHQIEEIYSEPELFDPDRFSPQRQEHKKYPFSLVGFGGGPRICIGIAFAK
MEMKIVAAHLLRSYHWEILPNQSLEVVAVPTNRPKDGLRVRFQPR

CYP120C1   Nostoc punctiforme
           NZ_AAAY02000127.1 GenPept ZP_00106106.1
           8154-9512 gene = Npun477
           44% to 120B1 36% to CYP120A1
MQQLKSAEEIPGSYGLPILGETLEIFRDSELYLWRRFQQYGSVF
KTSVLGRKRAYLIGPSANRLVLVEQAENMSSRIGWYFLESTFGNNILLQDGEEHRLTR
RLMYPAFHGKAIATYFDTIQNIVQDFLKDWGERGTISLNSSFRQLTLMIATRLFLGSQ
NKSEVEQTSQWFTQLLDSSMAIFKWNVPFTLYGRGQNARGKLVAFLREAIAQRIEQGN
LEESKDVLGLLLAAVDEDGNKLSETQVINEALLLLFAGHETTASLLTWVIFELGNHPE
WRERLRQEQLAVVGNNPLSLSHLKQFPQLTNVLKEAERLYPPVYAYNRGVLKDIEYGG
YRIPAGWFVTISPMLTHRLPELYTEPDRFDPDRFAPPREEDKKHPLALMGFGYGSHSC
LGMEFAQMEMKIVLSTLLRHYDWTVKPDYSAIAPVRQPSKVKDILQAYIEPLLIKHPL
DS

121 Family

CYP121A1   Mycobacterium tuberculosis
           GenEMBL Z77163 (42861bp) gi 1449344 Rv2276
           complement (32358 to 33548)
           unpublished

CYP121A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome 2526703..2527893
           Gene = cyp121 100% match
           locus_tag = Mb2299

122 Family

CYP122A1   Streptomyces sp.
           GenEMBL U65940( 2500bp)
           nearly identical to rapJ gene of St. hygroscopicus involved in 
           rapamycin biosynthesis

CYP122A2   Streptomyces hygroscopicus
           GenEMBL X86780 (107379bp)
           coding region 96465-97625
           rapJ

CYP122A3   Streptomyces hygroscopicus var. 
           GenEMBL AF235504 CDS 71460..72626 
           gene="fkbD"
           note="C9 hydroxylase" 89% to 122A1 77% to 122A2

123 Family

CYP123     Mycobacterium tuberculosis
           GenEMBL Z80226 (34809bp) gi 1550644 Rv0766c
           complement (8322-9530)

CYP123     Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome complement(861053..862261)
           Gene = cyp123 100% match
           locus_tag = Mb0789c

124 Family

CYP124A1   Mycobacterium tuberculosis
           GenEMBL Z77163 (42861bp) gi 1449354 Rv2266
           complement (39907-41193)

CYP124A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome 2519058..2520344
           Gene = cyp124 100% match
           locus_tag = Mb2289

CYP124B1   Streptomyces cinnamonensis
           GenEMBL AF440781 93981..95273
           polyether antibiotic monensin biosynthesis gene cluster
           41% to CYP124
           gene = monD
MGLTVGPDNAKRGIVPITDSKPAATFPDLVDPSFWARPHAERVA
LFEEMRGLPRPAFIRQNMPGVPWTFGYHALVKYADIVEVSRRPQDFSSNGATTIIGLP
PELDEYYGSMINMDNPEHSRLRRIVSRSFGRNMIPEFEAVATRTARRIIDELIARGPG
DFIRPVAAEMPIAVLSDMMGIPAEDHDFLFDRSNTIVGPLDPDYVPDRADSERAVIEA
SRELGDYIAGLRAERLAAPGNDLITKLVQVQADGEQLTRQELVSFFILLVIAGMETTR
NAISHALVLLTEHPEQKQLLLSDFDTHAPNAVEEILRVSTPINWMRRVATRDCDMNGH
RFRRGDRIFLFYWSGNRDESVFPDPYRFDITRGTNAHVTFGAVGPHVCLGAHLARMEI
TVLYRELLAALPQIHAVGQPRRLDSSFIEGIKHLHCAF

CYP124B2   Streptomyces nanchangensis NS3226
           GenEMBL AF521085 complement(100196..101467)
           polyether ionophore nanchangmycin biosynthetic gene cluster
           41% to CYP124
           gene = nanP
MNRGVVSPTEATPASSAKATRPPDFMDPSFWLRPRDERAEVFEK
LRALPGPEFVPPRLPWGPLASGYYALSKHADICEVSRRPQDFSSEGATAILPPEMDEF
YGSMINMDNPEHSRLRRIVARSFGRGMAPKFDAMSRRVARRIVDELIERGPGDFIRPA
AEMPIAVLSTMMGIPGEDYEFLFERTNTIMGGADPELAADPEKMAAAVLGALRDLGDY
IGRLREDRLARPGPDVITKLVQVQEDGEQLTNQELVSFFILLINAGMETTRNVIAQAL
VLLTEHPDQRQLLLSDFELHAKGAVEEILRVGTPINWMRRTATGDCEMNGHRFRKGDE
IFLFYWSANHDEKVFEDAYRFDITRDPNPHLSFGAVGPHFCLGAHLARIEIIAMLREL
LASLPDIRVEGEPVRLASSFIEGFKELSCTF

125 Family

CYP125A1   Mycobacterium tuberculosis
           GenEMBL Z82098 (34154bp) gi 1666115 Rv3545c also AD000003
           coding region 8135-9436

CYP125A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome complement(3927359..3928660)
           Gene = cyp125A1 100% match
           locus_tag =Mb3575c

CYP125A2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV5841 57% to CYP125A1 from Mycobacterium tuberculosis

CYP125A3P  Mycobacterium leprae
           GenPept CAC30983
           NC_002677 2415021..2416227
           locus_tag="ML2024
           Sequence below is from TIGR primary nucleotide sequence for ML2024
           51% to CYP125A1 Rv3545c Z82098 Mycobacterium tuberculosis
   1 PGFDFPDPEIYTEQLSV*EPAEMCQAETI**NEQPIGRSGFYDDDY 138
     XXXXXXXXXXXXXX
 174 HSGTFSNLEKTALACYQEGMNDEQISRGKLVLLNIDASQYTRLHKIISPGFIP*AAEQLR 353
 354 DDLXXXXXXXXXXXXXXX 362 
 410 SGDFVEHVSCELSRQAAIAGLPSG 481
 480 VPQEDCKKLFHWSN 521
 522 QTVGAQDPKFATNDPMVTSVKLIM*AMQIAADRAKPLGQVIVTNLVEADIEGHKLSKDEFGSF 710 
 713 VIMLTAAGKENTRNCIMQSMMQFTNFPD*WELYK 814 
 816 KKAPGTTADKIIRQATLVMS 875
 876 FQRTVLK*YELSSVSIKKGQRVVVIYRSANFDEKVLTIRLPCSIMRNPT 1022
1022 PHAGFNDTNVHYCIGIN 1072
1073 LARMTIDRMFHAIAESMPNL*STGKPK*LRSGWLNGVKHWQVD 1201

CYP125A4   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           75% to 125A2 before frameshifted region
           clone name SP0266

126 Family

CYP126A1   Mycobacterium tuberculosis
           GenEMBL Z80226 (34809bp) gi 1550656 Rv0778
           coding region 20888-22132

CYP126A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome 873620..874864
            Gene = cyp126 100% match
            locus_tag = Mb0801

CYP126A2P  Mycobacterium leprae
           GenPept CAC31567       
           NC_002677 complement(1384839..1385327)
           locus_tag="ML1185
           Sequence below is from TIGR primary nucleotide sequence for ML1185
           37% to CYP126 C-terminal
184 DRSLIPSAIEEGSRSETPNWASVTRITIA*LAIGGKTILPNAGVDILMGSANRDGSRWTE 363
364 PNTFDIHWPRQAHTTLAGSHMCLGIGLAQLDTRVMLNNLFD 486

127 Family

CYP127A1   Rhizobium sp.
           GenEMBL Z68203(34010bp) 
           coding region 29431-30675
           also AE000101 Rhizobium sp. NGR234

CYP127A2   Rhizobium sp. BR816
           No accession number
           Ellen Luyten
           Submitted to nomenclature committee 4/12/2000
           73% identical to CYP127A1

CYP127A3v1 Mesorhizobium loti
           GenPept NP_106463
           NC_002678 complete genome 4745586..4746803
           79% to 127A2
  1 MAINPVPDHV PPEMVRDFSL FTSPGMPPTP NGDPHAAVAC AHDGPPIFYS PYNTQDGRGT
 61 WVITRAADQR KVLQDTETFS SHRSIFSSIL GETWPTIPLE LDPPAHGAFR SLLSPLLSPK
121 RVTALEPAVR ERAIALIDRI TASATSCDVM KDFAFPFTVS IFLRFLGLPD QGLDTFVGWA
181 KDLLHGDDVE RPVAARKIVA FIDELATNRR KDPVDDLMTF IVQAQIEGRR LTDGEIRGIG
241 VLVFVAGLDT VAAAIGFDLA YLARNLKDQE LLRSEPARIL LATEELLRAY PPIQLIRVAT
301 KDIDFEGAPI RKGDYVSCAT MIANRDPEEF ESPNTVDLAR DHNRHAAFGY GPHRCLGSHL
361 ARREIVIGLE EWLARIPTFR IKEGTAPITC GGHVFGIENL ILDWS

CYP127A3v2  Mesorhizobium loti
            GenEMBL AL672114 complement(100678..101895)
            Strain R7A symbiosis island
            Gene = msi332
            2 DIFFS with CYP127A3v1

CYP127A4   Rhizobium etli symbiotic plasmid p42d
           NC_004041 97484..98974
           81% to 127A2
           gene = cpxA5
MHLCSERIYRKRGTRENPMSTGRAGEASKKFRLRPTKQRGFRAA
RRSDRCIACHWRLALLRLEIWRSTILLAPSPRRIRSRRRGFDDRRKAVATIRVPEHVP
PEMVKDFSLFTSPGMERMPNGDPHAAVACLHNGPRIFYSPCNTRDGRGTWVIVRAQDQ
RKLLQDTGTFSSHRSLFASALGENWPLIPLELDPPAHSVFRSLLNPLLSPRRIMELEP
AVRDRAIALISKISASSTSCDILTDFAFPFAVSIFLRLLGLSDERLNTFVGWGKDLLH
GDGIRRTAAARTILAFIDELAAMRRKEPADDFMTFVVQAKVDGRLLRDQEIHGIGVLL
FVAGLDTVATAIGFDLAYLARNPTEQELLRSKPDRIVLAAEELLRAYSTVQMIRVATK
DINFEGAPIRKGDYISCATMIANRDPVEFENPNTIDLAREDNRHTAFAYGPHRCLGSH
LARREIIIGLEEWLSRIPDFRIKDGTAPITYGGHVFGMENLILDWS

128 Family

CYP128A1   Mycobacterium tuberculosis
           GenEMBL Z77163 (42861bp) gi 1449352 Rv2268c
           coding region 37021-38490

CYP128A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome complement(2521761..2523230)
           Gene = cyp128 100% match
           locus_tag = Mb2291c

129 Family

CYP129A1       Steptomyces sp.
          GenEMBL U50973(3196bp)
          Dickens,M.L. and Strohl,W.R.
          Isolation and characterization of a gene from Streptomyces sp.
          strain C5 that confers the ability to convert daunomycin to
          doxorubicin on Streptomyces lividans TK24
          J. Bacteriol. 178, 3389-3395 (1996)
          gene name doxA

CYP129A2   Streptomyces peucetius 
           GenEMBL U77891 CDS comp (83..1330)
           gene="doxA"
           product="daunorubicin C-14 hydroxylase" 94% to 129A1 

130 Family

CYP130A1   Mycobacterium tuberculosis
           GenEMBL Z77137 (36096bp) gi 1480330 Rv1256c
           coding region 30691-31908 cy50.26

CYP130A1X  Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome
           CYP130 lies in a deletion in M. bovis

CYP130A2P   Mycobacterium leprae strain TN
            GenPept AL583920.1
            59% to CYP130A1
VMSHRFRFTTADIWPNPWSMYRTLRDHEAVHHVVPANQPEDDYYVLPRHADVWSMAMRS
HAKLSSAQRLTVNYSDMELIGLQDNPPMVMQDQPV*TKCRKLVSRRFTPRQTNVVEPKVR
HFVVEHIEQLRAKGSVDIVTELFKPLPPMVVAHYFGFPEKVRSQFDGW
TTAADGGGALFRFPRKSPITIRRLAPAIVAANTADAGGITNELDVAGYAVESMLAYFTR
IATGGNNTVTGMLGG*MPL
SHRRKQHRHWHARRLDAVKDTAEAD
LLRLTSSVRGLMRTTTRDVAIGHTTVSPGRRVLMRYGQAKRDER*YSAAAS*LDVTW*
PPNILIFSHGAH
YLGAKVTRMQRR
VRLTELLARYPDFEVDESSIAWAGGKLHTTP

131 Family

CYP131A1       Streptomyces peucetius
         GenEMBL L47164(3444bp)
         coding region 32-1348
         gene dnrQ  duanosamine biosynthesis
         possible sequence errors at C-terminal (no recognizable signature sequence 
         in the last 68 amino acids)

CYP131A2     Streptomyces sp.
         GenEMBL L35154 (4134bp)
         3838-4134 N-terminal fragment 94% identical to L47164
         gene dauQ daunomycin biosynthesis 

132 Family

CYP132A1  Mycobacterium tuberculosis
          GenEMBL Z80108 (40778bp) gi 1542902 Rv1394c
          complement (9842-11227)
          most often matches CYP4 family in blast search

CYP132A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome complement(1566263..1567648)
           Gene = cyp132 1 aa diff
           locus_tag = Mb1429c

133 Family

CYP133A1     Erwinia herbicola
           Randy S. Fischer, Roy A. Jensen
           First P450 from an enteric bacteria (similar to E. coli)
           submitted to nomenclature committee

CYP133B1v1     Xylella fastidiosa, section 35 of 22. 
               AE003889 CDS complement(3751..4959)
               82% to AE003887 48% to CYP133A1

CYP133B1v1   Xylella fastidiosa 9a5c 
             GenPept AAF83187                 
             100% match
  1 MKLTDLSNPA FLENPYPLYE TLRAQAPFVS IGPNALMTGR YSLVDSLLHN RNMGKKYMES
 61 MRVRYGDSAA DMPLFQAFSR MFITINPPAH THLRGLVMQA FTGRESESMR PLAIDTAHQL
121 IDNFEQKPSV DLVAEFAFPF PMQIICKMMD VDIGDAVTLG IAVSKIAKVF DPSPMSADEL
181 VHASTAYEEL AQYFTKLIEL RRTHPGTDLI SMFLRAEEDG EKLTHDEIVS NVIMLLIAGY
241 ETTSNMIGNA LIALHRHPEQ LALLKSDLSL MPQAVSECLR YDGSVQFTMR AAMDDIEVEG
301 ELVPRGTVVF LMLGAANRDP AQFTHPDQLD ITRKQGRLQS FGAGIHHCLG YRLALIELEC
361 ALTTLFERLP HLRLAHLDAL NWNQRSNLRG VNTLIVDLHA KN

CYP133B1v2  Xylella fastidiosa Temecula1
            GenPept AAO29526                 
            6 diffs to CYP133B1v1
  1 MKLTDLSNPA FLENPYPLYE TLRAQAPFVS IGPNALMTGR YSLVDSLLHN RNMGKKYIES
 61 IRLRYGDTAA DMPLFQAFSR MFITINPPAH THLRGLVMQA FTGRESESMR PLAIDTAHQL
121 IDNFEQKPSV DLVAEFAFPF PMQIICKMMD VDIGDAVTLG MAVSKIAKVL DPSPMSADEL
181 VHASTAYEEL AQYFTKLIEL RRTHPGTDLI SMFLRAEEDG EKLTHDEIVS NVIMLLIAGY
241 ETTSNMIGNA LIALHRHPEQ LALLKSDLSL MPQAVSECLR YDGSVQFTMR AAMDDIEVEG
301 ELVPRGTVVF LMLGAANRDP AQFTHPDQLD ITRKQGRLQS FGAGIHHCLG YRLALIELEC
361 ALTTLFERLP HLRLAHLDAL NWNQRSNLRG VNTLIVDLHA KN

CYP133B1v3 Xylella fastidiosa Dixon
           NZ_AAAL01000071 complement(6849..8057)
           98% to 133B1v1 7 diffs 97% TO 133B1v2 11 diffs 
           gene = XfasA0474
MKLTDLSNPAILENPYPLYETLRAQAPFVSIGPNALMTGRYSLV
DSLLHNRNMGKNYMESMRVRYGDSAADMPLFQAFNRMFITINPPAHTHLRGLVMQAFT
GRESESMRPLVIDTAHQLIDNFEQKPSVDLVAEFAFPFPMQIICKMMDVDIGDAVTLG
MAVSKIAKVFDPSPMSADELVHASTAYEELAQYFTKLIELRRTHPGTDLISMFLRAEE
DGEKLTHDEIVSNVIMLLIAGYETTSNMIGNALIALHRHPEQLTLLKSDLSLMPQAVS
ECLRYDGSVQFTMRAAMDDIEVEGELVPRGTVVFLMLGAANRDPAQFTHPDQLDITRK
QGRLQSFGAGIHHCLGYRLALIELECALTALFERLPHLRLAHLDALNWNQRSNLRGVN
TLIVDLHAKN

CYP133B2v1  Xylella fastidiosa, section 33 of 22 
            AE003887 CDS 6723..7925
            82% to AE003889 48% to CYP133A1

CYP133B2v2  Xylella fastidiosa Ann-1
            NZ_AAAM01000051 complement(2764..3966)
            97% TO 133B2v1 8 diffs
            gene = XfasO1476
MKLADLSSPAFLENPYPLYETLRRQGPFVSIGPNALMTGRYSIV
DGLLHNRNMGKSYMESIRVRYGDDALDMPLFQGFNRMFLMLNPPVHTHLRGLVMQAFT
GRESESMRPLATDTAHRLIDDFEQKSSVDLVTEFSFPLPMRIICRMMDVDISDAISLS
VAVSNIAKVFDPAPMSPDELVHASAAYEELAHYFTRLIELRRAQPGTDLISMLLRAEE
EGQKLTHDEIVSNVILLLLSGYETASNMIGNALIALHRHPKQLARLKSDLSLMPQTVL
ECLRYDGSVQFTVRAAMDDVSIEGDVVPRGTIVFLMLGAANRDPAQFTDPDHLEITRK
QGRLQSFGAGVHHCLGYRLALVELECALTVLLERLPHLRLANLDTLSWNQRGNLRGVN
ALIADLHP

CYP133B2v3  Xylella fastidiosa Dixon
            NZ_AAAL01000066 complement(2275..3477)
            97% TO 133B2v1 9 diffs 10 diffs to CYP133B2v2
            gene = XfasA0420
MKLADLSSPAFLENPYPLYETLRRQGPFVSIGPNALMTGRYSIV
DGLLHNRNMGKSYMESIRVRYGDDALDMPLFQGFNRMFLMLNPPVHTHLRGLVMQAFT
GRESESMRPLAIDTAHRLIDDFEQKSSVDLVTEFSFPLPMRIICRMMHVDISDAISLS
VAVSNLAKVLDPAPMSPDELVHASAAYEELAHYFTRLIELRRAQPGTDLISMLLRAEE
EGQKLTHDEIVSNVILLLLGGYETTSNMIGNALIALHRHPKQLARLKSDLSLMPQAVL
ECLRYDGSVQFTIRAAIDDVSIEGDVVPRGTIVFLMLGAANRDPVQFTDPDHLEITRK
QGRLQSFGAGVHHCLGYRLALVELECALTVLLERLPHLRLANLDTLSWNQRGNLRGVN
ALIADLHP

CYP133B3   Xanthomonas axonopodis pv. citri str. 306
           GenPept AAM38014                 
           56% to 133B2
  1 MLLSDLATPQ FRHDPYPTYA RLREEGPLVQ VADGRLMSGR YAVVDRLLSD RRVGRDYLQS
 61 VRLRYGEAAV HLPLFQGMSR MFLLLNPPLH TQLRGLMTQA FGARQMESMR EVASDIAAGL
121 IDAFQANGHC DLLTEFAFPL PIAIICRMLD IAAADVTALS HATSALAKVF DPMMTAEELQ
181 ATSVAYDQLA TYFHGVIAQR RSAGGDDLIA RFIQAEDNGR RLSEEEIVSN VILLFFAGHE
241 TTSNMICNAL VALHRHPQQL RLLQETPGLL PNAVLECMRY DSSVQMATRT ALQDFEIEGV
301 AVPRGTMLYL MLGAANHDTL QFTDPQVLDI RRQQGRALSL GGGIHHCLGN RLALIEVEAA
361 LACLLARLPA LRLEQLDTLS WNDRANLRGV DALLASW

CYP133B4   Xanthomonas campestris pv. Campestris str. ATCC 33913
           GenPept AAM42318                
           BioI biotin synthesis
           52% to 133B2 65% to 133B3
  1 MQLSDFATPA FRQDPYPMYA RLRAAGPLVQ ISDNGWVSGH YTVVDALLSD RRVGRNYLDS
 61 IRVRYGANAA EMPLFQGMSR MFLLLNPPVH TQQRALMTKA FGARQLEALR EVAVDTADAL
121 LDQHEDRRSC DLLNDFAMPM TISLICRMLG LAVTDVAALG QASSALAKVF DPLMRPEDMA
181 QATAAYTTLE QYFRAIVLQR RDTQEDDLIA RLIAAEDHGQ RMPVDDIVSN VIMLFTAGHE
241 TTANMICNAL IALHRHPEQL QLLRDTPTLM PNAVLECMRY DSSVQVAMRS VLQPLQVEGT
301 TLPVGAILYL MLGSANHDAE QFTAPQQLDL RRQQGRALSF GGGVHHCLGN RLALIELETA
361 LERLLQRAPA LRLPELDNLS WNERANLRGI QALHATW

CYP133B5   Ralstonia solanacearum GMI1000 megaplasmid
           GenEMBL AL646080 77388..78584
           gene = RSp0709
           77% to CYP133B2v2
MKLADLSTPSFLENPYPLYETLRSQGPFVRIGPNALMTGHYSIV
DALLHNRQMGKSYMESIRLRYGDEGPNMPLFQGFSRMFLMLNPPMHTRLRGLMMQVFN
ARQIESMREVATATAHQLIDDFEQKPSADLVAEFAFPLPVRIICQMMDLDIDDAMALG
VGVSKLAKVFDPAPMSADALVETSAAYEELAQYFTKVIEARRAQPGTDLISMLMRAEE
NGETLTHDEIVSNVILLFIAGHETTSNMIGNALIALHRNPQQLDLLKREPSRMPNAVL
ECLRYDGSVQVTIRAALEDVEVEGEVLPRGTTVFLMLGAANRDPAQFTDPDQLDIGRQ
QGRLQTFGAGIHHCLGYRLALIELESALGALFERLPNLRLTNLDQLSWNQRGNLRGVN
ALMAAW

CYP134A1   Bacillus subtilis
           GenEMBL AF017113, Z99121, Z99122
           cypB also called cypX

CYP134A2P  Bacillus cereus ATCC 14579
           GenPept AAP10061   
           57% to CYP134A1 cypX Z99122 Bacillus subtilis C-term
 1 MIGATNCDSN VFERPDKFNV YRPDIDIKKA FSGTARHLAF GLSIYNCVGV AFAKLKIEID
61 STIKDNISRK KLRDIKDFVK KTSKMN

CYP134B1   Photorhabdus luminescens subsp. laumondii TTO1
           GenEMBL NC_005126 complete genome complement(313663..314886)
           locus_tag = plu0296
           46% to CYP134A1
MAKLSSFNIHDPKFIKNPYDFYDILHKQDLVYFEQSQNSYFIGK
YEDVDAILKSSIFNTKPLTALAEPVMGDRVLAQMEGEEHACKRKFIMQGLSRDYFNRY
YEPMIRKITEDLLQPYMEKGNIDIVNDFGRDYAVLVTLSILGLPSDNYRDIAEWHKGI
ASFITQFDQTELEKMHSLECSQKLIRLLKPIIDQRRRNPSKDIISIFCQDTAMSMSEI
TALCLNILLAATEPADKILAMMLNHLISNPSMLDVVLKDRSLVRDAFEETLRLTSPVQ
LIPREASEDVTISGIDIPKGAVVFCMIGAANRDPSVFHKPNEFDLYRRKNTTSPQKAN
RKRHLAFGAGTHACAAAAFSLSQLEVSSNIILDLLHNLRFADHYHYQETGVYTRGPSK
LLLSFDPIASSAIKE

CYP135A1    Mycobacterium tuberculosis
            GenEMBL Z96800
            Rv0327c

CYP135A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(393726..395075)
            Gene = cyp135A1 1 aa diff
            locus_tag = Mb0334c

CYP135B1    Mycobacterium tuberculosis
            GenEMBL AL021942
            Rv0568

CYP135B1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome 660693..662111
            Gene = cyp135B1 100% match
            locus_tag = Mb0583

CYP136A1    Mycobacterium tuberculosis
            GenEMBL Z83866
            coding region 23158-24636
            Rv3059

CYP136A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome 3376038..3377516
           Gene = cyp136 1 aa diff
           locus_tag = Mb3085

CYP136B1    Mycobacterium abscessus
            GenPept AAN38721 
            46% to CYP136A1
  1 MDAVEAAQRP GGTMTNHLLA PAHHVKERLS SVIMVPAPHA VDDRWRRWSR DWPVRELAPA
 61 PAGSGLKAVR GDAGLPFVGH TLDYIRFGSD FSRERYDRLG SVSWMGAFGT KMVVIAGPDA
121 TREAFTSEAK AFSQDGWSFL IDAFFHRGLM LMSFDEHLMH RRIMQEAFTR PRLTGYVEQV
181 TPCVRSAVPA WPVGPSVRIY PLLKELTLDI ATDVFMGGRG KDESDAVNKA FVATVRAASS
241 LVRAPLPGTR FRAGVQGRRV LEDYFFRHLP AARAGETEDL FAALCQATTE DGERFSDEDV
301 VNHMIFLMMA AHDTSTITTT AVTYFLAKYP QWQEAAAAEA AAIGDGLPDI EALEKMTVID
361 RVIKEALRLL APVPLVMRKT VRDVAIDGYH IPSNTLCAIT PAVNHFDRTI WNDPERFDPS
421 RFDEPRREDQ HHRFAWVPFG GGAHKCIGMQ FGTLEVKAIL HRMLRSFTWK VPENYHVRWD
481 NTSLPIPVDG LPLEMKRR

CYP137A1    Mycobacterium tuberculosis
            GenEMBL AL022121
            Rv3685c

CYP137A1   Mycobacterium bovis subsp. bovis AF2122/97, 
           NC_002945 complete genome complement(4064642..4066072)
           Gene = cyp137 1 aa diff
           locus_tag = Mb3710c

CYP138A1    Mycobacterium tuberculosis
            GenEMBL Z92770
            Rv0136

CYP138A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome 163556..164881
            Gene = cyp138 100% match
            locus_tag = Mb0141

CYP138A2P   Mycobacterium leprae
            GenPept CAC32181 GenEMBL AL583926
            NC_002677 complement(3167438..3168451)
            locus_tag = ML2648
            Sequence below is from TIGR primary nucleotide sequence for ML2648
            40% to CYP138
  1 NRVAREIVVEVIYGALFGAFEALSGLVPQDTVLGPMGRYSMAPSLIR
439 ITINVIMRAGFGSELDELRRLHPTAATL 522
    RWTVERQARCNHDIFMLDSRSTAERLRRRLHGTCMKNH 351
352 VRIFEAEPLWGLRTGLKASLLPHCRLINRITINVIMRAGFGSELDELRRLHPTAA 516
517 TLVGLF*LLSQHLGVLADPSSMGATMPGDDPAPALRQATIPG
638 LGVQWTRTVIDFAARRVYSSVYHLSEWAIPREDSILISIAQIYXXXXXXXXXXXX 766
795 DPRRYVEHKPSSFAWI 842
    PFSGGT 861
862 SRCVSICQDGDGMNVVLKMVLRYWIIDTTTAPGER*HLRGVVYTPRNGGR 1011

CYP139A1    Mycobacterium tuberculosis
            GenEMBL Z95617 GenPept AAK45973 (with 7 more aa at N-term)
            Rv1666c

CYP139A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(1877656..1878948)
            Gene = cyp139 start codon differs by 6 aa
            locus_tag = Mb1694c

CYP139A2P   Mycobacterium leprae 
            GenPept CAC31622 GenEMBL AL583921.1
            NC_002677 complement(1474970..1475188) and
            complement(1474991..1475161)
            locus_tags = ML1237 ML1238
            61% to CYP139A1
GAAVATTSMTVILARLASRTRLHLLAHYTHRVRARNFAALIP*LSLTVEVINSMPTQ

CYP140A1    Mycobacterium tuberculosis
            GenEMBL Z97193
            Rv1880c

CYP140A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(2120751..2122067)
            Gene = cyp140A1 100% match
            locus_tag = Mb1912c

CYP140A2    Mycobacterium ulcerans
            No accession number
            Pam Small
            Submitted to nomenclature committee 10/17/2003
            62% to CYP140A1

CYP140A3P  Mycobacterium leprae TN
           GenEMBL L01095.1
           48% to 140A1
VRQRLHWFAQYGFIRGIAATHH
RRSDPLARLDIALAIKANPVP
YCHKPRPRRPLVQSRISYLTANRAITHELLQSEDFHVFWLNVTLPAPSHWL
RRRTGYRTSSQYNL
LHPLLAIQ*AYHIHYRKTVSPLFAPKAVATLRDRIEQTTLALLDQLAHQHDVVDVVNRY
CSQLPVAVISDILGYP
VPDRDRSHILKFGELVAPSLDVELT*Q*YQQA*REVAGFNFWL
LKHLPQLQRTPGDNLVRHLSH*EDNKPTEISLSKSKLQAISG
GLVLATGGETTVNLLGRGI
LLLDTPEHMVMLQACPEPGHKRG*EILRLDSPIQMAARVARKDVDLAGSTIKRSQVVVLY
FGRSQPGPVRLCRSR*VQHRTPQCGKESRIFR*QEFCLENALTRAYNAVGLRAFFDHLP*
TRAAGTRSRLDTRVLRGWSTLPIALGPTRSMVS

CYP140A4   Mycobacterium avium subsp. paratuberculosis 
           GenEMBL AJ250018 complement(2795..>3145)
           59% to 140A1 runs off end
GAAARQSRPVGPRRSRRSCDRQPGPDDRAHAPPATSTSAPAMVG
LVPRRARNRDPKVFSDPTTFDVTRPNAREHLAFASGIHACLGAALARIEGATCARSFE
NFPDRSSRARNGGR

CYP141A1    Mycobacterium tuberculosis
            GenEMBL Z95150
            Rv3121
            cosmid cY164 from Sanger Centre
            coding region 29289-30488

CYP141A1P   Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome 3441289-3441483
            aa 337-400 (first part of gene is in a deletion)
IAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT*

CYP142A1    Mycobacterium tuberculosis
            GenEMBL
            Rv3518c

CYP142A1aP  Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(3898119..3898736)
            gene = CYP142A1a aa 1-197 100%
            locus_tag = Mb3548c
            In Mycobacterium bovis, a frameshift due to a single base
            deletion (c-*) splits cyp142 into 2 parts (pseudogene)

CYP142A1bP  Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(3897541..3898122)
            gene = CYP142A1b aa 207-end 100%
            locus_tag = Mb3547c
            In Mycobacterium bovis, a frameshift due to a single base
            deletion (c-*) splits cyp142 into 2 parts (pseudogene)

CYP143A1    Mycobacterium tuberculosis
            GenEMBL AL022021
            Rv1785c

CYP143A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome complement(2013905..2015086)
            Gene = cyp143A1 100% match
            locus_tag = Mb1813c

CYP143A2P   Mycobacterium leprae
            GenPept CAC30494                
            NC_002677 1861010..1862160
            locus_tag = ML1542
            P450 pseudogene
            Sequence below is from TIGR primary nucleotide sequence for ML1542
            55% to CYP143 Mycobacterium tuberculosis Rv1785c
   1 MSTSAKANPTHFTYCSLNYSALSMITDRGVIWKTLXX 105
 113 AKPVVFMNG*YYLNVSRKCILHTTSITKGFSSREAXXX 217
 225 PGNALPVLPXXXXXXXXXXXXXXXXXXX 251 
 278 SLNNLNKALPALRTYTVTMANAITSRGEW 364 
 366 EAMTDFANX 389
 391 LFPLQLFLVL*GLXX 429
 434 AQDRDHLIALLKDVVIGMSDKPFLSQADIADQGELCEYLVDTIAERKQNPA 586
 585 PDVLSQVLIGEDPLSEIKVLDLESL 659
 659 MLILAELDTVTATVGFSLLQPACRQQLRTMLRDKPKQIRILIED 790
 792 ILQLEPPAQITPYITTEFVNVDGMTLSPGSRVRLC 896
     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
 993 GSHLARLKLTLAVDEWLINI 1052 
     XXXXXXXXXXXXXXXXXX
1116 LFALKALALHW 1148

CYP144A1    Mycobacterium tuberculosis
            GenEMBL Z97345
            Rv1777

CYP144A1    Mycobacterium bovis subsp. bovis AF2122/97, 
            NC_002945 complete genome 2001114..2002418
            Gene = cyp144 1 aa diff
            locus_tag = Mb1806

CYP145      Nocardioides sp.
            GenEMBL AB000735
            gene for 2-carboxybenzal

CYP146      Amycolatopsis orientalis
            GenEMBL AJ223998
            cosmid PCZA361 (gene 2 of 2)

CYP147A1    Myxococcus xanthus Partial missing C-term 
            GenEMBL AF111947 CDS 1939..>2877
            42% to AF087022 partial  new family

CYP147B1    Streptomyces avermitilis
            No accession number
            Submitted by David Lamb and Haruo Ikeda 9/3/02
            Clone name SAV584 50% to 147A1 from Myxococcus xanthus
            (147A1 is missing C-term so could be higher % identity)

CYP147C1    Streptomyces tubercidicus strain I-1529
            No accession number
            Istvan Molnar, Syngenta Biotechnology, Inc.
            Submitted to nomenclature committee June 2, 2003
            Clone name CypEA
            50% to 147A1

CYP147D1    Magnetospirillum magnetotacticum
            GenEMBL NZ_AAAP01002628 
            complement(814..1824) gene = Magn3224
            N-terminal is about 61 aa short
            51% to 147B1 44% to 147C1
MCAPGPGRDPQCGTGRSSSGDPPDHDRLRGQVMRCFTPQRVRGM
REKTRRITDDLIAKMAGKTRIDLVDDFSYPLPVTVICELLGVPPEDEAQFHGWATQLA
TALEPNQRGDEETQAKNEVCFNEIADYIQGLIKEKRKNPQEDILSDLATDTDGMNDFD
LIATAVLLLVAGHETTVNLITNGMLTLLRFPEHLERLRAEPETAPRLIEELLRYEPPV
HYRTRLALADIPVAGITIPKDAPVILLLAAANRDPLRFSDPDRFDPDRPDNRHLGFGG
GLHYCVGAPLARIEAEVALVSLVRRLKGLSLTENPPPYRPGASLRGPCHLRLALEEVA
EG

CYP147E1   Methanosarcina barkeri Archaea; Euryarchaeota
           GenEMBL NZ_AAAR01001943 4935..6305
           52% to 147D1 probable lateral transfer
           gene = Meth3340
MYRQGSGPNDRRQTMTQQSLYEQVLDYANRANPYPLYAKLRQTP
ITRQIDGSYVVSTYREIVSLLHDPRIGSDFRMRSA
HDRPSAGLSANQELASKNQAQDEGAETSSSNQGSETEVV
PSFIGLDPPEHDRLRRQATWPFGPPHTPGRVADMEPELILLA
NRQIDTIKGRTSIDIVEDFAYPIPVTMISELLGVPPEDQPRLHALSEAIIEDIDLDPR
QSPEEQKRRQEQSSQTFKELEQYMEVLIEHHRKQPGSDLLSGLITDHGSDGPMAQADL
VSTASLLLIAGHETTVNLITNGMLTLLRHPDVLERLRREPDLVIRLVEEFLRYEPPVQ
ILPNRVALSDITIAGTTIQKGSPVILLLASGSRDPARFHDPEKFDPDRRDNMHLGFGS
GIHYCYGAPLARLETQIALTELVQRLENPRLAHDPPPYRQSATLRGPRHLIVEIDGVK
DWEFHL

CYP147F1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           55% to 147B1 if 9 aa removed, 54% to 147E1
           clone name SP0549

CYP148A1    Deinococcus radiodurans R1 
            GenEMBL AE002083 CDS 1719..2948
            38% to AL049754 complement(10413..11648)

CYP148A1    Deinococcus radiodurans
            GenPept AAF12079 
            GenEMBL NC_001263 2539498..2540727
            Gene = DR2538
  1 MTASSGSSAP SSGPLLAAVQ GLWSGAALAD PHPIYEQIRG FANADGLVRL PEWNTAFAVG
 61 HAATSAVLRS PAARSGEWDH GPSDGGKLLQ HMMLFRNGIP HARLRGLVQK AFTPRVVEEQ
121 RDLVRSLLDE LLSDMARAGG PVDLVAGLSG PLPGRVIMRM LGLRGADEER FLGWSASVAE
181 LLGGADRSPA LLARIEADAR EMRGYFRDLA DELRVSPQPG LLSALAAVED GGERLSGDEL
241 LSNAVLLLAA GHETTSNLIP GGVLALSQQP GAWAALLNHP RHPGVADELL RHVSPVQLDG
301 RMLTEAQTVG ETPLPAGTPV QLLLAAANRD PQVFPDPERL DWDRPNASRH LAFAAGPHYC
361 LGASLARLEI AETFAALAER FPDLRVSAAP HYKANFVLRG PQELWVTLG

CYP149A1    Microcystis aeruginosa 
            GenEMBL AB036790 CDS complement(779..2254)
            gene="mapks"
            41% to 107H1 partial seq new family

CYP150A1     Mycobacterium species
             GenEMBL AF107046
             Pascal Poupin
             gene 1

CYP150A2     Mycobacterium smegmatis mc2155
             GenEMBL AF107047 1092..2405
             Pascal Poupin
             gene 2 
MTDSTATDPAATTPDFDTVDYFTDQSLVPDPHPYFDHLRSKCPV
VREPHYGVLAITSFEEATTVLKDTETFSSCIAVGGPFPPLPFTPEGDDITGQIEQHRT
QLPMFEHMVTMDPPEHTNARSLLNRLLTPKRLKENEDFMWRLADECLDDFIDDGSCEF
LKQYAKPFSLLVIADLLGVPEEDHDEFRHVLGAPRPGAIVGSLDGDQLAMNPLAWLDD
KFVRYLEDRRKEPRDDVLTALATAKYPDGSTPEVIDVVRSATFLFAAGQETTTKLLSA
SLRVLGDRPDIQQALREDRSRIPTFVEEALRMDAPVKSQFRLAKKTTQLGGVDVPAGT
TLMVCPGAVNRDPVRFEDPHTFSLDRKNVREHIAFGRGVHSCPGGPLARVEGRVSLER
ILDRMADIRIDEEHHGPADNRRYTYEPTYILRGLTDLHIKFEPVR

CYP151A1     Mycobacterium smegmatis
             GenEMBL AF102510
             Poupin P, Ducrocq V, Hallier-Soulier S, Truffaut N
             Cloning and Characterization of the Genes Encoding a Cytochrome
             P450 (PipA) Involved in Piperidine and Pyrrolidine Utilization and
             Its Regulatory Protein (PipR) in Mycobacterium smegmatis mc2155.
             J Bacteriol 181, 3419-3426 1999

CYP151A2     Mycobacterium sp. strain RP1
             GenEMBL AJ310142
             Pascal Poupin 
             Submitted to nomenclature committee March 22, 2001
             86% identity in 399 aa overlap with CYP151A1

CYP152A1    Bacillus subtilis
            GenEMBL AB006424
            ybdT gene
            this sequence is missing part of the heme signature sequence, but has 
            PERF and EXXR

CYP152A2    Clostridium acetobutylicum
            GenPept AAK81262                 
            YBDT B.subtilis ortholog
            59% to 152A1
  1 MLLKENTAKD KGIDSTLDLL KEGYLFIKNR ADHYQSDLFE TRLMGQRIIC MTGEEAARIF
 61 YDSDKFKRQG AAPKRVQETL LGENAIQTLD GESHLHRKKL FMLLTNQVQQ KRLAELTTEK
121 WEASASKWHT KSIVLFNEAN EILCQVACHW AGVPLMESDI KNRAEDFSSM IDSFGAVGPR
181 HWKGKKARNT IEAWIKEIIE NVRSGRIRAE EGSPLHEIAF YIDVNGQQMP AEMAAIELIN
241 ILRPIVAIST FITFSALALY EHSEYREKLQ SKDIRYLEMF TQEVRRYYPF APFVGARVRK
301 DFLWNNCEFK KEMLVLLDIY GTNHDSRIWQ KPYEFIPDRF RSYKGNLFDF IPQGGGDPSS
361 THRCPGEGIT LEIMKTSLDF LSTKIDFTVP DQDLSYSLSK IPTLPKSGFI IDNINLKL

CYP152B1    Sphingomonas paucimobilis
            GenEMBL AB006957
            Isamu Matsunaga
            this sequence is missing part of the heme signature sequence, but has 
            PERF and EXXR

CYP152B2    Azotobacter vinelandii
            NZ_AAAU02000007 102969-104183
            56% to CYP152B1 with two frameshifts 
            may have 10 aa deletion after aa 136
MHRIPRDKGLDSTLALLHDPYRFIARRCRLHGSNLFETRLLLRKTLCMSGAEAARLFYDP
ERFVRHGAMPPRLQKTLFGVGGVQGLDGEAHRHRKHMFVALLMDAERVAQLVEAVRGEWR
TCARRWERMEKVVLYD 
CAWAGIPLAEEEAGPRAREIALLFDYAGSVGPKHWRSRLARRRSEAWMGALVESIRASRR
QPPAETAAQVISWHRGLDGNLLEAR
VAAVELLNVIRPVVAIAVYLTFVAHALHRYPHCRHGLRSGDAEYREWFVQEVRRFYPFFPA
VVARVRQDFEWRGYAFPAGRRVMLDLYGTDHDVRLWQAPETFRPERFGSREYGPCDFIPQ
GGGEHESGHRCPGERIVMKLGADVLARELSYAVPMQNLEIDFSRLPALPRSRFVMSDIHGAP*

CYP152C1   Rhodobacter sphaeroides 
           GenEMBL NZ_AAAE01000129 complement(38633..39955) 
           gene = Rsph2136
           40% to 152A1, 41% to 152B1
MTTDEGRRPEEPGTPASLREMPRDPRIDASMALMSEGYRFVSNL
CDRMDSDAVATRLRLREVVCLRGSAAARLLYGAEGLTRVGAMPSTVLHLLQDKGSVQQ
LEGPAHRHRKALFLSICMDPARVEALVSEMRLAWRERLPAWEAEGRIVLQQEAARLLT
RAGCRWAGVAHQPEAQLADEIFDMIDKAGSVGPRNWLAQMRRAGTEKRLRTLVEEVRA
GEVVPEAATALHAIAFHREEDGTLLDPSVAAVELLNLLRPIVAVGRYITFAALALHRE
TTWRELFRSGNLELAGDFAEEVRRASPFFPFTAAVTTRPITWEGYDFPEGQWLLLDLY
GTTHDPRHFPEPTRFRAERMLSWTGQDEAFIPQGAGDVARTHRCPGEMITVELMKEAI
RLLCCEMDYEVPAQDLGVRLNRMPAQPRSGMILSAISRRAGTEASRNG

CYP153A1    Acinetobacter calcoaceticus
            No accession number 
            MAIER; T; FOERSTER, H.H.; ASPERGER, O. AND HAHN, U.: 
            Cloning of an unusual 56 kDa-P450 from the n-alkane-assimilating 
            bacterium Acinetobacter calcoaceticus EB104. 
            Unpublished
            32% identical to CYP111
            trivial name P450EB104

CYP153A2   Caulobacter crescentus CB15
           GenPept AAK22050                 
           NC_002696 complete genome 61849..63153
           56% to 153A1
  1 MMSQNTDPRE DLMSDGSIDL KADARARAYS IPLEDYHVAD PALFQADAMW PYFERLRKEA
 61 PVHYSKGDEE VGPYWSVTRY NDIMTVDTTH QVFSSDAHLG GITIRNFDED FVLPMFIAMD
121 QPKHDIQRKT VSPIVSPANL GRLEGIIRER VCGILDALPI NEPFDWVDKV SIELTTQMLA
181 TLFDFPWEER RKLTRWSDIA TASPESGLIE SEEARRAELL ECLAYFTNLW NERVNLTEPG
241 NDLISMLAHG EATRDMPPME YLGNVILLIV GGNDTTRNSL TGGLYALSKN PQEEAKLRAD
301 PGLIPNMVSE IIRWQTPLAH MRRTALEDYE LAGQTIKKGD KVVMWYVSGN RDDTVIENAD
361 QFIVDRPNAR RHLSFGFGIH RCVGNRLAEM QLKIVWEEIL KRFPKIEVLE EPKRVYSTFV
421 KGYERMMVRI PERI

CYP153B1   Bradyrhizobium japonicum USDA 110
           GenPept BAC47118
           NC_004463 complete genome 2007526..2008767
           49% to 153A1
  1 MNRRLEIHRA DDGYIIPLSE LDVSEGKRFQ DDSIWGCFER LRREDPVHYC QNSAHGPYWS
 61 ITKYRDIVAV DTNHHAFSSQ QGVTIVEVPD KHWTPSFIKM GPPQHAEQRN TVSPIVGPES
121 LTRLETLIRS RVRMILDGLP RNEVFNWVTK VSIELTTQTL ATLFDFPFED RRLLTYWSDA
181 AVTTPKAGYA IDSWDKRSTI LSECLDYFTR LWNERINAEP RLDLISLMAH SPVTRHMEPT
241 EFLGNLILLI VGGNDTTRNS ITGGLLFMSQ YPSELRKLTD NPKLISSAVS EIIRYQTPIA
301 HMRRTAAIDS IVGGKPIRTG DKVVMWYISG NRDEEVIENA NSFVIDRKNV RQHLSFGFGI
361 HRCLGRHLAE LQLRVLWEEI LDGGLKIKVV GEPERIASNF VHGYSALPVR IEA

CYP153B2   Bradyrhizobium japonicum USDA 110
           GenPept BAC52507                 
           NC_004463 complete genome 7964879..7965991
           51% to 153A1
  1 MHYCKDSMFG PYWSVTRYND IMEIETNHSV FSSASALGGI TIRDIDPDLR RESFISMDPP
 61 RHAAQRKTVA PMFTPTHLDN LALNIRARSA ECLDNLPRGE VFDWVDRVSI ELTTQMLAVL
121 FDFPWEDRRK LTRWSDIATT IPGPDGLVAT EDERQAELTE CAGYFARLWK ERIEQPPKSD
181 LLSMMAHGAA TRDMDAKNFL GNLVLLIVGG NDTTRNTMSG SIYALSQHPE QYRKLRENPA
241 LLDSFVPEVI RWQTPLAHMR RTALSDFEFR GKQIKKGDKV VMWYVSGNRD EEAIEKPYDF
301 IIDRARPRTH LSFGFGIHRC VGLRLAELQL KIIWEEILKR FDHIDVVGEP KRVYSSFVKG
361 LETLPVKIAA

CYP153B3   Bradyrhizobium japonicum USDA 110
           GenPept BAC52508                 
           NC_004463 complete genome 7966159..7967508
           51% to 153A1
  1 MDGRRRRPMP LPQAGEVRKT TGATTMNIQT PVKVDKAERM RRARGEAYAT PLAQFHPGAP
 61 RLFQDDTLWP WFERLRKEEP VHYCTNAPIE PYWSVVKYND IMHVDTNHGI FSSDSTLGGI
121 SIRDVPEGYD YPSFIAMDQP RHSAQRKTVS PMFTPTHLDE LAKLIRQRSQ TVLDNLPRNE
181 TFNFVERVSI ELTTQMLATL FDFPWEERRK LTRWSDVSTA LPKSGIVASA EERRREMDEC
241 YAYMSKLWNE RVNSAPRNDL LSLMAHNDAT RFMDPDNLMG NIILLIVGGN DTTRNTMTGS
301 VLALNENPEQ YDKLRANPAL IDSMVPEVIR WQTPLAHMRR TALQDTEIGG KQIKKGDRVV
361 MWYVSGNRDE EAIDRPNEFI IDRPRPRTHL SFGFGIHRCV GMRLAELQLK IVWEEMLKRF
421 DRIEVVGEPK RIYSSFIKGY ESLPVRIPG

CYP153B4   Rhodopseudomonas palustris
           NZ_AAAF01000001 
           complement(3283981..3285270) gene = Rpal2887
           80% TO 153B3
MTWPGRTTMHGTIETGKAARLRAAREEAYATPLKDFHPGAPRHF
RDDTLWPWFERLRAEEPVHYCTNAPIEPYWSVTKYNDIMHVDTNHQIFSSDSTLGGIS
IRDAPVGYDWPSFIAMDEPRHSAQRKTVSPMFTPQHLDELAVLIRGRTQKVLDGLPRG
ETFNFVDRVSIELTTQMLATLFDFPFDERRKLTRWSDVATALPKSGVVDSEQQRRDEL
NECAAYFARMWNDRVNSEPRNDLLSMMAHHDATRTMDRDNLIGNILLLIVGGNDTTRN
TMSGSVLALNENPHEFEKLRANPKLIDTLVPEVIRWQTPLAHMRRTALQDAELGGKTI
RKGDRVVMWYVSGNRDDEVIERPEEFIIDRARARIHLSFGFGIHRCVGMRLAELQLRI
VWEEMLKRFERIEVVGEPKRVYSSFVKGYESLPVRVS

CYP153B5   Burkholderia fungorum
           NZ_AAAJ02000161
           complement(10797..12332) gene = Bcep0832
           56% to 153B2
MRHVSCLRRSRLERSRGRARRPGGFHADLFTDPQGQLAALLPDR
GARGTRRTGPAPSRRPALTTLARHSNPVPDKALAPLTRNCHSAKVNCMNTLVVDSSHV
RLAPDALSQPVEDIDPSLPYRFQQQTHFAMFDRLRRESPVHYVKDSEYGPFWSVHRYN
DIIDVEIDHATFSSDVKYGGMLIKDLPENMRRTSFINADPPLHDHQRRVVSPIVAPGN
LNRLEHTIRREAADILDGLPRGETFDWVDNVSIELTGRVLCELMDFPRADRRLLTYWS
DIVNVDLEVGGEINTEEKRYVKLKECASYFGVLFKERMNSEPKDDLISMLAHSEYTKN
MPEQEFLGMIVLLMVGGNDTTRNSISGGLVALNQFPEQYAKLHNDPGLIPKLVPEILR
WVTPVTHMRRTATRDIEFRGKQIRQGDKVVVWYASGNRDSDVIKDPYQFIIDRANPRL
HLSFGFGIHRCLGNRLAELQLRVLWEEILKRQMLIEMMGEPVRKYANNITGVMALPVRIAA

CYP153C1    Novosphingobium aromaticivorans
            GenEMBL NZ_AAAV01000116
            complement(18298..19530) gene = Saro1194
            45% to 153B4
MAATLAPDRAINPHDVSLNALYTEDRWREPFRWLRENMPVSYRA
ESPFGAYWSVVTHDLIQQVELDPGTYSSSWQRGNITIADSVNETEFPNFIAQDPPIHT
AQRKVIAPAFGPSQMVKLERLVRERTTQLLDGLPMGEEFDWVERVSIPLTLGMLLILF
DMPFDEWRDIKRWSDWASGVSEDSLNDAYRAEFVQQMGQMLMRFDRELEARRALPPSD
DLLSRMVHSDAMGHLTPPERIANIALLIVGGNDTTRNSMSGLIEALHRYPAELDKLRA
DPALSANAAQEIIRWQSPVTHMRRTLTRDAELGGQRLAEGDKIVMWYISGNRDENVFP
DAERFDVTRENARRHIGFGHGIHRCVGARLAEVQIAAVIEEIATRRLRITPQGAPTRL
ASPFLHGFTAMPVVMSRD

CYP153D1   Novosphingobium aromaticivorans
           NZ_AAAV01000178 
           4242..5579 gene = Saro3794
           47% to 153C1
MATQLAPEVPQFTYHSSPTATEAFAAWLKDNPQAIPAHSHPWDV
SRSDIYVEDRWQPIFAEMRAKAPVNRVPDSPYGAYWNVASHKAIMHVESLPELFSSSW
QYGGITIGDPPEDVDPQKLAERQLPMFIAMDRPDHTGQRRTVAPAFTPAKMVEMEAEI
RRRTASVLDSLPWGERFDWVDKVSIELTTGMLAILFGFPWADRRLLTFWSDWAGDVEL
TLARELADTRFGFLGEMAHYFQRLWGARMQAPPSGDLISMMIHSEAMNHMSPQEFMGN
LVLLIVGGNDTTRNTMSGIVHALDKFPDQRELLERDASLIPNAVQECIRYVTPLAHMR
RTATADTELFGNQIKAGEKVILWYISANRDETVFENPDKLMVDRPNARRHLSFGHGIH
RCVGARLAELQLRILLEEMHERRMRVRVAGEVERVRANFVHGFRKLEVELEKR

CYP154A1    Streptomyces coelicolor cosmid E6 
            GenEMBL AL353832 CDS 17561..18787
            51% to AF145049 42% to AL158061 complement(14764..15987) 
            38% to 107A1, 107B1 39% to AF087022
            cloned and expressed by David Lamb and Steve Kelly

CYP154A2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV109 70% to 154A1 from Streptomyces coelicolor

CYP154A3   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           75% to 154A1
           clone name SP0673

CYP154B1   Streptomyces fradiae tylosin-biosynt. 
           GenEMBL AF145049 CDS 3108..4409
           51% to AL353832 CDS 17561..18787 44% to AL158061    
           complement(14764..15987)
           39% to 107C1

CYP154B2   Streptomyces avermitilis
           GenEMBL AP005036
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3704 64% to 154B1 from Streptomyces fradiae 
           A tylosin-biosynthesis gene in fradiae

CYP154C1   Streptomyces coelicolor cosmid 6D11 
           GenEMBL AL158061 CDS complement(14764..15987)
           44% to AF145049 42% to AL353832 CDS 17561..18787 39% to 107C1 
           cloned and expressed by David Lamb and Steve Kelly

CYP154C2   Streptomyces avermitilis
           GenEMBL AP005036
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3882 87% to 154C1 from Streptomyces coelicolor

CYP154D1   Streptomyces avermitilis
           GenEMBL AP005026
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV1308 47% to 154A1 from Streptomyces coelicolor, 
           46% to 154B1, 45% to 154C1

CYP154E1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000039b 
            99628..100836 gene = Tfus2243
            49% to NZ_AAAQ01000042a   154F1
            47% to NZ_AAAQ01000029a   154G1
            46% to 154D1
MGQSRRPHTVYLDPAKGVDIPAQRRELLDKGPVVRVAFPGNLEV
WALTHDAPLRNALADESVFVRGWRNWRALMAGEVDPTHPVANMLRVESMLARSGADHK
RMRGLVQAAFTRRRVEALRPRIEEITNELLDRMAESDGVVDLKAAYSFPLPIRVISEL
LGLNEEDHLTLQTLVTRTLSGTDPEANADAFTFVASLIEAKRKNLDDGLISAMIEARA
EDGDRLSETELIHNTLLLIIGGFETTMGMISNSVQLLLTHPDQLHLLRTGQASWENAI
EECLRFESAVVMLPFLYTTRDVEIDGITIPAGDAVLIGFGPANRDPQAYDDPDRFDIT
RPRPRHLAFGHGAHLCLGAALARLELLIALPALFERFPDITLVGEAPPTPTVFMNHPL
SRPVLLRPKP

CYP154F1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000042a 
            complement(347138..348745) gene = Tfus3014
            49% to NZ_AAAQ01000039b 154E1
            44% to 154C1 and 154C2
            N-terminal extension may be incorrect
MAVSADHAAAGALPGARHPAGRRVRAGRRLLDHRLRSGTRRPGG
CPVHRPAQPVRDPRPPGVGDRAPRVPGAADLPADRGRRGECAAGPVAGRASRGSPRVA
GAAPFPVRPRTQGASCHLHPRRHHPTNGGT

MAAVPEPIVLVPGKSREQALQLREAGPL
ARVVVEGLEVWALTHDRELREALIDPRFRRNWRTWRALNEGEVATDHPVAAMVYLDNM
LTVDGEAHRRMRSPVAQAFTPRRVELLRPRVTEIVNALLDQLAERDGTVDFKTEFAYP
LSMRVFSALFGIPERDHGRMQQMVNTAFSPSSPEEVRAMREELDAFLDELIEDKRRSP
GEDLTSALVTATDEEHKLSDAELRDTLWLLVTAGFETTSSALANAVQTLLTHPDQLAH
LRSGSIAWEDAIEEVLRQSSSVATLPFLFAAEDVQIGDRTIRAGEPVLLAYLAANLDV
ERYGEDAAEFDATQSRPRHLAFGHGPHTCLGAALARLEMEVALTTLFTEFPEVSLAEG
EAPRLESVFIHAPAALPIRLGPRRTAA

CYP154G1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000029a 
            complement(12913..14079) gene = Tfus0891
            47% to NZ_AAAQ01000039b 154E1
            41% to 154C1
MLDTERGLTEADIHALAEHGPVVRLSVMGLDVWAVTGYEELRTL
MADPEVKRGVEHWTAVAQGKVPAEHPLVKLVSMGSMLSKNPPEHTRLRRLVQHAFTTR
RVEGLRPVVQELTRACLDRIDASQPFDINAALSHPVPVGVIGRLLGIPETDQPALDSL
VTRLLSGTDATVHEELYAYVAAMVAARREQPDDGLISALLHVHDDDGSTLSEEDLMWT
VVLLVDAGFETTVGQISNSVRLLLEHPDQLALVTSGEVPWERAVEECLRHTASVVMLP
FCFPTREKELGGYTIGAGEPVMMVYGAANRDSRVHAAPKVFDVTRSDSRHITFGHGPH
HCLGAPLARLELNVVLPELFARFPKLALAERDIPRVKSLFVNRPSELWVTAGMG

CYP154H1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000035b 
            93951..95183 gene = Tfus1569
            51% to 154C2
MMASPTDNPIVLDPYVSDLEGERERLYEAGPIAWVELPGGVRTW
SVTHHQAARELLTDSRLSKNMAHWGAYNRGEISPTWPLLSVIPPTPTNLLGTDGAEHK
RLRTLTAQAFTPRRVEKLRPRIREITEELLDALEERANEPQDLKSEFSFKLPMRVIGE
LYGVEEAAHGQLRSLYDKFFSSVTPPEEFLATREALVQFYTELMERKKANPSDDLTTA
LLQANENGDRMTDEEVLGTLQIVVAAGHETTVNLLTNTVRALLRFPDQLELLRTGKAT
WEAAIEESLRWDPPTTNFIFRFATEDIEYGGVTIAKGDSVMISYGAIGRDRGQHGDNP
EVFDVTRKTSSRHISFGYGPHVCPGAPLARLEAQVALPMLFERYPDMKLAVDDSELVP
NPSVIVNSLKEFPVILRP

CYP154J1    Streptomyces carzinostaticus subsp. neocarzinostaticus
            GenEMBL AY117439 
            complement(35390..36622)
            47% to 154B1
MCPYRLDPEGADTHGETARLREQGPIARVELQDGVLAWSVHDYA
VAKQIMADERFSKNPRKNWPAYINGEISNGWPLITWVAMDTMATQDGADHARLRKLLL
KAFTERRVESMRPHIEKTVKELLDNMAAKADDEIVDIKEMFHAELPTRLMCDLFGVPE
ERRAEVLAGGHKNIDTRISSEAAEANLGQWQEAISDLVEYKRHHPGDDLTSALIEARD
EGSRLSDSELIGTLHLLLGAGSETLVNALAHSSLALLVDADLRKKVTSGEIPWVNVWE
ETLRVESPVAHLPFRYATEDFEIGGVKISKGDPLLVDFAGIGRDPAVHSDAPDEFDAL
RPDKTHLSFGHGVHYCLGARLAKHAWMIGIPALFERFPDMELAVRRDELKGQGSFVVN
GHASLPVHLKGRAAALAR

CYP154K1   Streptomyces rochei plasmid pSLA2-L
           NC_004808 complement(144081..145325)
           53% to 154B2
           note = ORF84 
MLRQEAPYVIDSAGRDLPGEAARLRERGPVVRVVLPGGVSAWAV
TDLDLIKQLLTDSRASKDAYRHWPAWAGGEVDESWQMSMWVSVRNMLTAYGEEHARLR
RLVAGAFTARRTADLRPRVERITARLLDGLAAVPPGAAVDVRNEFARPLSVLVMGETL
GLPEDLHADLQRMVDVLFKTTAEPEEARANQYELYALLTELVAARRSAPGTDLTSELI
AARDEDGGEGLSEKELVDTLLLLIGAGTETTVNLIDQAVHGLITHPAQLALVLGGEAT
WDSVIDETLRHQPVVANVPFRFAVEDIEVGGVTIPKGDPILLSLAAAARCPHRHGADA
DQFDVARPSRRDHVPFGYGVHHCVGRPLARLEVSIALESLFARYPRMAAAVPEAELAV
RESFISSGHVALPVVLVPGAAA

CYP155A1      Streptomyces coelicolor cosmid 6D11 
              GenEMBL AL158061 CDS complement(40542..>41807)
              32% to AF127374 new family
              cloned and expressed by David Lamb and Steve Kelly

CYP155B1   Deinococcus radiodurans
           NC_001264 192795..193784 
           frameshifted C-term, frameshift not a seq error
           43% to 155A1 
MPSFLSFRSSAMTAHDAQPEPARCPFTGQAAPTETITRRHVPPQ
GDLAQPVETYARARDLLKSEQAQQAGFLADMVSRVPGSQHPPVLYLEGEEHTEMRRAT
AKYFTPTQVNTYQPDIARLADELIGKLARRGEAKLDDLSLELAVRVAAGVVGLTNSRL
PGMDRRIERFIPSGVDAEPGVKLEGASPLENARQAANMALFYALDVKPAIEARRKAPQ
DDLISYLLSRGYNDQDILTECVTYGTAGMITTREFISVAAWHLLKNPELRAAYVHGTE
KERHAVLHEILRLEPVVGTLYRRA
GTGDDCGRRSHPAGSVFALDIGQANLDPAVMGEGAEQLCPMRELPRGVQAQGLSFG
DGHHRCPGAFLAIKETDVFLRRLLIWNDLHVVSEPRVTYNEVIKGYELRGFRVRLGGARA*

CYP155B2P   Deinococcus radiodurans
            GenEMBL NC_000959 73..384 
            plasmid CP1
            44% to 155B1
            C-term only runs off end might be a full gene
SGSTDAEILPYVVEAEPSSPVVHLDISQ
ANRDESVFTQAQQFCPHRKNVRQHLSFGKGEHACLGQSLVYTICRVMAHALELLSAPAGQ
RTDQVSQ*

CYP156A1      Streptomyces coelicolor cosmid E6 gene 
              AL353832 16317..17549
              34% to AL158061 complement(15984..17225)
              cloned and expressed by David Lamb and Steve Kelly

CYP156B1      Streptomyces coelicolor cosmid IF3 gene 
              AL590982.1 10933-12276
              41% to 156A1
              cloned and expressed by David Lamb and Steve Kelly

CYP157A1      Streptomyces coelicolor cosmid 6D11 
              GenEMBL AL158061 CDS complement(15984..17225)
              51% to AL132991 complement(7477..8739) 40% to AL132648
              cloned and expressed by David Lamb and Steve Kelly

CYP157A2   Streptomyces avermitilis
           GenEMBL AP005036
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3881 86% to 157A1 from Streptomyces coelicolor

CYP157A3    Thermobifida fusca
            GenEMBL NZ_AAAQ01000035a 
            92419..93954 gene = Tfus1568
            55% to 157A1
MGPAVHRGARRSRPRRRPPTRRLLVLHRPAGGARHSLRRRPQQL
RVLLHPGPDPRGTRPGPLSPPPGMRRPGTRVRQTGAGHPGPTCDDDHRGGGRPMNAQR
GIPSSHQNAFRLYGPQFQNKPAELYRQMRTDYGPVAPVLLDGDIPAWLVIGYREVTHV
LNHPETFARSSRRWNAWDLVPENWPLYPMVTRTPNILYSEGEEHRRRATAISDALSGA
DQHEVRQYAVQAADRLIDGFCAASRADLRADYASRLPAIVLGRLYGLDQKHAEVLAEA
MTTMIDSGPDAVKAQQFLLQTMGTLVAERRKQPGPDVVSRLVHHPAKLRDEELIPDLV
VILGGGHQPTTEWLGNTLRLMLTDDRFAASLTGARSSVREALNEVLWEDTPTQIYLGR
YAAHDVELGGQLIRRGDLVLLGLAGANSDPQINPGPECRMSQGNQAYLSFSHGEHRCP
YPAPELAEIIVTAGIEVLLDRLPDVELAVPVDELRWRPSPWMRGLVALPVVFTPVPPI
GGQ

CYP157B1      Streptomyces coelicolor cosmid F55 
              GenEMBL AL132991 CDS complement(7477..8739)
              51% to AL158061 (15984..17225) new family
              cloned and expressed by David Lamb and Steve Kelly

CYP157B2   Streptomyces hygroscopicus subsp. yingchengensis
           AY260760 complement(2270..4150)
           P450 fusion protein
           83% to 157B1 C-term part
           gene = shy2
           note= fusion to ATP/GTP binding protein at N-term
MGSATSELPSQRTPLTAAAETGLKIVVVGGFGVGKTTLVRSVSE
IRPLNTEELMTQAGQGIDETAGVERKTTTTVAFDFGRISLNDRMVLYLFGAPGQERFW
FLWDRLFAGTLGAVVLVDTRRMEDCWYAIDRLEHHGTPFVVAVNRFDGDEKRFSLDEV
RQALALGEHVPMIECDARVRASGKEVLIALVDHLYTRALAKESTACSDTTGFPSTDAP

PPGCPAHGSAVPLAGLEYQQTPSQLYRTLRREHGAVAPVLLDGGIPAWLVLGYPEVCY
VTAHDELFARDSRRWNQWEHIPPDWPLLPYVGYQPSVLFTEGAEHQRRAGVITQALEG
VDQFELARECQLIAARLISSFSGSGRAELMSMYAHALPARGVLWMCGMPAEDADTERL
VDDLRISLDAGEGDDPVAAYTRVGERIMRLVKEKRERPGPDVTSRMILHPAGLGDEEI
VQDLISVIAAAQQPTANWICNTLRLLLTDERFAVNVAGGRVSVGEALNEVLWLDTPTQ
NFIGRWAVRDTQLGGRHIREGDCLVLGLAAANTDPQIWPEPHAGSGNSAHLSFSNGEH
RCPYPAPLLADVMARTAVETLLEHLPDLVLAVEPEELTWRPSIWMRGLTSLPVEFTPA
MN

CYP157C1      Streptomyces coelicolor cosmid I41 
              AL132648 CDS complement(9396..10892)
              40% to AL158061 (15984..17225) 39% to AL132991 complement(7477..8739)
              cloned and expressed by David Lamb and Steve Kelly

CYP157C2   Streptomyces avermitilis
           GenEMBL AP005047
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV6706 70% to 157C1 from Streptomyces coelicolor

CYP157C3   Streptomyces griseus
           GenEMBL AB044803 3754..5328
           61% to 157C2
           gene = rarE
MTTPFHHEPGTVPPPQCPAHNLDIGPGGLRRLHGPEAENNPAGL
YDKLRAEHGTVAPILLHGDVPAWLVLGHSENLHVTRTPSQFSRDSRRWRALQDGSVAP
DHPLAPIFTWQPICVFADGPKHERQRGAVTDSMERIDTRGVRRHINRFSNRLVNDFCE
KGTADLVGQFAEHLPMMVVCAIFGMPEEYDERLVQAARDMTRGTETAVASNAHIVSVL
TRLVERRRAEPSPDLASWLVEHPATMTDTEVIEHLRLIMIAAYESTANLIANVLRMVL
IDPRFRARLSGGHMTVPEAVEQTLWDEPPFTAVFGRWAVGDTELGGQQIKAGDALLVG
IAPANTDPTVRPDLGADMGGNRAHLAFSGGPHECPGQDIGRAIADVGVDALLMRLPDL
ELGVGESELHWVGNIMSRHLVELPVKFAPGPQQKLDADPLTVMARLLAPPTPGRSPPR
PGRSPSPATRGPWRRAHAPGAAPTAEPDPAPAAPPAPEPAAAPEPAPVATIPQQRRPA
APARFWQAVTRWWSGY

CYP157C4   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           57% to 157C3
           clone name SP0618

CYP158A1      Streptomyces coelicolor cosmid 8F11 
              AL353864 CDS complement(25687..26910)
              40% to AF254925, 107E1, 107F1 34% to 107A1 probably a new family
              cloned and expressed by David Lamb and Steve Kelly

CYP158A2    Streptomyces coelicolor 2StG58 [Full Sequence] Sanger cosmid 
            AL939108.1 CDS 76346-77560 61% to 158A1
            Note this sequence shows greater than 40% identity to some CYP107 
            subfamilies
            cloned and expressed by David Lamb and Steve Kelly

CYP158A3   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV7130 58% to 158A1 from Streptomyces coelicolor

CYP158B1   Saccharopolyspora erythraea
           GenEMBL AY078067 4211..5416
           gene = rppB
           red pigment gene cluster
           47% to 158A3
MTDRCPARMYDPADLPGMTFDPVFLELLRDEPVARIRMRYGEGE
AWLLTRYEDVKFVTSDPRFSRKIMGRPFPKMTKHHIPMDRAISFSDPPEHARVRRVVA
RDFSPGSIERLRPTGREIMHRYLDELVASGPPADLVRHVTSPFPMAVLGELMGIPESD
RQWLIDCSSQVLSMAPDQAAVDRINGIKAEVAEYFLALVESRRADPRDDVVSTVAAAR
ERGDLDDEEVGAMTVLLALNGWHAVRNNSTNMVYVLLTDPELRSRLKADLALVPTAVE
ELLRYIPHKRGIGQPRIATEDVDIRGVRISKGDVVYVSYIAANWDEEVYPEPDRVDLD
RPEVPHLAFGHGPHYCMGPMLARMESQVLLSSLLTRLPDLALAVPPEQVAWQPNALIR
GPVELPVTW

CYP159A1      Streptomyces coelicolor cosmid F55 
              GenEMBL AL132991 CDS 6235..7458
              41% to 107K1 41% to 134 new family
              cloned and expressed by David Lamb and Steve Kelly

CYP159A2   Streptomyces hygroscopicus subsp. yingchengensis
           GenEMBL AY260760 983..2209
           84% to 159A1
           gene = shy1
MSAAHHLPDILSPEFAANPYPAYAVMREKEPLIWHEATQSYIIS
RYEDVERVFKDKKAEFTTDNYNWQLEPVHGKTILQLSGREHAVRRALVAPAFRGSDLE
QKFLPVIERNSRELIDAFRHTGSADIVNDYATRFPVNVIADMLGLDKADHARFHGWYT
AVIAFLGNLSGDPEVAAAGERTRVEFAEYMLPVIRERRANPGDDLLSTLCAAEVDGVR
MSDEDIKAFCSLLLAAGGETTDKAIAGILANLLSHPDQLAAVRADRSLIPAAFAETLR
YTPPVQMIMRQSATDVEVTGGTIPAGATVTCLIGAANRDERRYRDPDRFDIFRDDLAT
TSAFSAAAGHLAFALGRHFCVGALLAKAEVEVGLNQLLDAMPDLRLADGHDLVEQGVF
TRGPKTLPVRFTPVTA

CYP160A1      Streptomyces lavendulae LinA homolog.
              GenEMBL AF127374 CDS complement(43595.44782)
              gene="mmcN" 39% to D87924 new family

CYP161A1      Streptomyces noursei ATCC 11455 nyst.
              GenEMBL AF263912 CDS 57095.58279 gene="nysL"
              function="presumably involved in modification of the
              nystatin macrolactone ring" 36% to AF127374 = new family

CYP161A2   Streptomyces natalensis 
           GenEMBL AJ278573 81418..82611
           pimaricin biosynthetic gene cluster.
           58% to 161A1
           gene = pimD
MTAASHDLPCLNLEPPKMLKLSPLLRALQDRGPIHRVRTPAGDE
AWLVTRHAELKQLLHDERIGRTHPDPPSAAQYVRSPFLDLLISDADAESGRRQHAETR
RLLTPLFSARRVLEMQPKVEEAADTLLDAFIAQGPPGDLHGELTVPFALTVLCEVIGV
PPQRRAELTTLLAGIAKLDDREGAVRAQDDLFGYVAGLVEHKRAEPGPDIISRLNDGE
LTEDRVAHLAMGLLFAGLDSVASIMDNGVVLLAAHPDQRAAALADPDVMARAVEEVLR
TARAGGSVLPPRYASEDMEFGGVTIRAGDLVLFDLGLPNFDERAFTGPEEFDAARTPN
PHLTFGHGIWHCIGAPLARLELRTMFTKLFTRLPELRPELPVEQLRLKEGQLSGGFAELRVVW

CYP161A3   Streptomyces nodosus
           GenEMBL AF357202 56829..58019
           gene = amphL
           amphotericin biosynthetic gene cluster
           71% to 161A1
           note = probably hydroxylates amphotericin precursor at C-8
MVNPTPPPSLEDAAPSVLRLSPLLRELQMRAPVTKIRTPAGDEG
WLVTRHAELKQLLHDERLARAHADPANAPRYVKSPLMDLLIMDDVEAARAAHAELRTL
LTPQFSARRVLNMMPMVEGIAEQILNGFAAQEQPADLRGNFSLPYSLTVLCALIGIPL
QEQGQLLAVLGEMATLNDAESVARSQAKLFGLLTDLAGRKRAEPGDDVISRLCETVPE
DERIGPIAASLLFAGLDSVATHVDLGVVLFTQYPDQLKEALADEKLMRSGVEEILRAA
KAGGSGAALPRYATDDIEIADVTIRTGDLVLLDFTLVNFDEAVFDDADLFDIRRSPNE
HLTFGHGMWHCIGAPLARMMLKTAYTQLFTRLPGLKLASSVEELQVTSGQLNGGLTEL
PVTW

CYP162A1   Streptomyces tendae nikkomycin 
           AJ250199 CDS 22..1212 gene="nikQ"
           38% to AF170880 new family

CYP163A1   Streptomyces spheroides novobiocin 
           AF170880 CDS 9688..10911 gene="novI"
           38% to AJ250199 new family

CYP163A2   Streptomyces roseochromogenes subsp. oscitans
           AF329398 15196..16419
           Clorobiocin biosynthetic gene cluster
           90% to 163A1
           gene = cloI
MSTRPTVSPDELEQIDLASPILHAEYELGEVFRYLRANRPMYWQ
QPRGEQPGFWVISRYADVNEVYKDKAHFTTEHGNALATLLTGGDSASGAMLAVTDGVR
HHQVRNLLSKGFSPQMLDLIANSLRETVDGLLLAALDRGECDAAQDIAANVPLGAICD
LLEIPQTDRKYLLGLTAHAWSTDYADETPEEGWVAKNEILLYFSKLLKERRGGDRDDM
VSLLANCRIDGHPLNAAEQVANCYGLMIGGDETGRHAITGTILALIENPDQWRALKNG
DVDLKTATEEALRWTVPSLHGGRKATGDVVINGQQIKAGDVVSVWISSANRDEAIFDA
ADEFKLARTPNKHFTFAYGSHYCLGHYLGRMEVYAVLDGLRRLVGDLEQIGEERWIYS
SILHGMSSLPIRITV

CYP163A3   Streptomyces antibioticus
           GenEMBL AF322256 22228..23478
           simocyclinone biosynthetic gene cluster
           62% to 163A1
           gene = simI
MNPRPMLSPDVLEDIDLNDRQLHADYDLSEVWRYLRAERPFYYQ
TARGSQPGFWVVTRHADCTAVYKDKTNFTAERGNVLPTLLAGGDSASRTMLALTDGDR
HTQVRNLLMKAFSPKMLSNIGQSLRTTVDGLLRDAIEKGECDFARDVSGKVPLVAICD
LLAVPQEDREYLLSLTAHALSADEADATAEDNWTAKNEILLYFADLAESRRSSGHNDV
VSLLATSSIEGEPLSDGELMANCYGLMIGGDETGRHAITGGLRALIHHPDQWRMLRNG
EADLQTATEEVLRWTVPSLHGARTATADVVVNGKQQIRAGEIVSVWFASANRDEEVFR
DADRFDLNRTPNKHLTFAFGPHFCLGHYLARMEVEAILDGLRRMVDDIQQTGPEKLIY
SSILQGISSFPALLKPDRRVPPQT

CYP163A3   Streptomyces antibioticus
           GenEMBL AF324838 26497..27762 
           simocyclinone biosynthetic gene cluster
           gene = simD1
           note="involved in aminocoumarin formation"
           same seq as AF322256 except this seq has MKGTM added
           at the N-terminal (a disagreement on start codon)

CYP164A1      Mycobacterium leprae cosmid B1788 
              GenEMBL AL007924 CDS complement(38296-39228)
              40% to AL049754 partial 

CYP164A1      Mycobacterium leprae 
              GenPept CAC31043                
              NC_002677 complement(2481544..2482848)
              locus_tag = ML2088
              100% match but this is complete
  1 MRTCVPTRTC VYAFIEYLSH NRPMGTNPPS LVEAQMLLLR LIDPGTRADP FPVYRALIDY
 61 GPMQLPGMPL TVFSSFSDCD EALRHPLSAS DRLKATLAQQ AIAAGAEPRP FYASSFMFLD
121 PPDHTRLRKL VSKAFAPKVV QALEGDIAAL VDSLLDKGAA AGQFDVIADL AFPLAVAVIC
181 RLLGVPYEDA PEFGRVSALL VQSVDPFITI TGEPPEATEE RLRAGVWLRD YLEQLVKCRR
241 GTPGEDLISR LIELDESGDQ LTEEEIIATC GLLLVAGHET TVNLIANAVL AMLRNPSQWK
301 ALSSNPQRAP LVVEETLRYD PAIHLIGRVA AKDMTIGQTT LTEGDTMVLL LAAANRDPAV
361 YSRPDEFDPD RPSSRHLAFA VGSHFCLGAA LARLEATVTL SAISARFPQV QLAGELVYKP
421 NVAMRGMSAL PVQV

CYP164A2P     Mycobacterium leprae cosmid B1450
              GenEMBL AL035159.1 
              45% to 164A1 C-term region before heme binding seq
AVDALLCFLSPPGLAGPRFAVTDVEIGQHTVVAGQTVRLYLASANHDPQRFNCTDELEPTRPAPHTA

CYP164B1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           45% to 164A1 missing about 112 aa at N-term
           clone name SP0831

CYP165A1    Amycolatopsis mediterranei 
            Y16952 CDS 224..1399 gene="oxyA"
            85% to AJ223999 CDS 31325..32500 42% to Y16952 CDS 1449..2645 
            41% to AJ223999 32520..33740

CYP165A2    Amycolatopsis orientalis cosmid PCZA363.
            GenEMBL AJ223999 region 31325-32500
            van Wageningen,A., Kirkpatrick,P., Williams,D., Harris,B.,
            Kershaw,J., Lennard,N., Jones,M., Jones,S. and Solenberg,P.
            Sequencing and analysis of genes involved in the   
            biosynthesis of a vancomycin group antibiotic
            Unpublished

CYP165A3    Amycolatopsis orientalis
            GenEMBL AF486630
            Zerbe,K., Pylypenko,O., Vitali,F., Zhang,W., Rouset,S., Heck,M.,
            Vrijbloed,J.W., Bischoff,D., Bister,B., Sussmuth,R.D., Pelzer,S.,
            Wohlleben,W., Robinson,J.A. and Schlichting,I.
            Crystal Structure of OxyB, a Cytochrome P450 Implicated in an
            Oxidative Phenol Coupling Reaction during Vancomycin Biosynthesis
            J. Biol. Chem. 277 (49), 47476-47485 (2002)
            oxyA 
            84% to CYP165A2
MFEEKNALRGTEIHRRERFDPGPELRALMAEGRMSVMESEESPG
GRTGWLATGYEETRQVLGSDKFSAKLLFGGTAAGRIWPGFLNQYDPPEHTRLRRMVAS
AFTVRRMRDFRPRIEAVVKATLDDIEATGGPVDFVPRFAWPIATTVICDFLGIPRDDQ
AELSRVLHASRSERSGKRRVAAGNKYWTYMGQVAAKTRRDPGDDMFGAVVREHGDDIT
DAELLGVAAFVMGASGDQVARFLSAGAWLMVEHPEQFAVLRDDPDSVPDWLNEVARYL
TSDEKTTPRIALEDVRIGDQLVKKGDAVTCSLLASNRHRFPDPEDRFDITREKPSHVT
FGHGIHHCLGRPLAEMVFRTAIPALAHRFPTLRLAEPDREIKLGPPPFDVEALLLDW

CYP165A4   Streptomcyes toyocaensis strain NRRL 15009 
           GenEMBL U82965 AF039028 complement(11438..12613)
           72% to CYP165A1
MFEEINVVRASQLHRRDRFDPVPELHSLMKEGGLTVLGTEDSTE
GRTAWLATGIDEVRQVLGSDKFSARLLYGGTAAGITWPGFLTQYDPPEHTRLRRMVVP
AFSHRRMQKFRPRVEQIVQDSLDTIESLGGPVDFVPHFGWAIATPATCDFLGIPRDDQ
ADLARILLASRTDRSDKRRTAAGNKFMTYMKQHVAQSRRGSGDDLFGIVGRENGDAIT
DAELTGVAAFVMGAAADQVARLLAAGAWLMVEQPAQFALLREKPETVPEWLDETMRYL
TTDEKTHPRVATQDVRIGNQLVKAGDTVTCSLLAANRPNYPSAEDEFDITREKAEHLA
FGHGIHHCLGRAMAELMFKVSIPALAHRFPTLRLADPQREITLGPPPFDVEALLLDW

CYP165A5   Actinomadura sp. ATCC 39727 
           GenEMBL AJ561198 complement(23387..24568)
           gene = dbv14
           gene cluster for biosynthesis of
           glycopeptide antibiotic A40926
           function="cross-linking of amino acids 2 and 4"
           72% to 165A1
MEVFEELNVVLPGELHWRDRFDPVPQLRSFMAEGPMTELGAEEG
PGGRTAWLATGFDEVRQVLGSDKFSSRLLYGGTAAGIVFPGFITQYDPPEHTRLRRVV
SPAFTVRRMERFRPQVDQVVEDCLDAIESIGGPLDFVPHFGWSIATTATCDFLGIPRD
DQAELSRSLHASRSQRAASRRGAAGNKFMTYMGQVVARTRRDPGDDMLSVVVREHGDE
ITDAELTGLAAFVMGAGGDQVARFLAAGAWLMAEVPEQFALLRDKPDVVPDWLEEMVR
YLTIDEKLTPRIALEDVRIGDRIVKAGDTVTCSLLGANRRHFPGPDDQFDLTRDRAPN
VAFGHGIHHCLGRPLAELIFRSAIPALARRFPALRLAEPEQEIRLGPPPFDVKALLLDW

CYP165B1    Amycolatopsis mediterranei 9.9kB DNA 
            Y16952 CDS 1449..2645 gene="oxyB"
            87% to AJ223999 32520..33740 47% to Y16952 CDS 2795..4015 
            47% to AJ223998 gene 1 53% to U84350 partial 

CYP165B2    Amycolatopsis orientalis cosmid PCZA363.
            GenEMBL AJ223999 region 32520-33740
            van Wageningen,A., Kirkpatrick,P., Williams,D., Harris,B.,
            Kershaw,J., Lennard,N., Jones,M., Jones,S. and Solenberg,P.
            Sequencing and analysis of genes involved in the   
            biosynthesis of a vancomycin group antibiotic
            Unpublished

CYP165B3    Amycolatopsis orientalis
            GenEMBL AF486630; AAL90878.1
            Zerbe,K., Pylypenko,O., Vitali,F., Zhang,W., Rouset,S., Heck,M.,
            Vrijbloed,J.W., Bischoff,D., Bister,B., Sussmuth,R.D., Pelzer,S.,
            Wohlleben,W., Robinson,J.A. and Schlichting,I.
            Crystal Structure of OxyB, a Cytochrome P450 Implicated in an
            Oxidative Phenol Coupling Reaction during Vancomycin Biosynthesis
            J. Biol. Chem. 277 (49), 47476-47485 (2002)
            Zhang W., Zerbe K., Vrijbloed J.W., Robinson J.A.
            DNA sequence coding for P450 monooxygenases of vancomycin producer
            87% to CYP165B1 and 85% to CYP165B2
MSEDDPRPLHIRRQGLDPADELLAAGALTRVTIGSGADAETHWM
ATAHAVVRQVMGDHQQFSTRRRWDPRDEIGGKGIFRPRELVGNLMDYDPPEHTRLRRK
LTPGFTLRKMQRMAPYIEQIVNDRLDEMERAGSPADLIAFVADKVPGAVLCELVGVPR
DDRDMFMKLCHGHLDASLSQKRRAALGDKFSRYLLAMIARERKEPGEGMIGAVVAEYG
DDATDEELRGFCVQVMLAGDDNISGMIGLGVLAMLRHPEQIDAFRGDEQSAQRAVDEL
IRYLTVPYSPTPRIAREDLTLAGQEIKKGDSVICSLPAANRDPALAPDVDRLDVTREP
IPHVAFGHGVHHCLGAALARLELRTVFTELWRRFPALRLADPAQDTEFRLTTPAYGLT
ELMVAW

CYP165B4   Streptomcyes toyocaensis strain NRRL 15009 
           GenEMBL U82965 AF039028 complement(9077..10273)
           77% to CYP165B1
MSGDDRPPIHTLRQGFDPADELRAAGELTRVRLGSGADAEHTWL
ATGHDVVRQVLGDHTRFSTRRRFDRNDEIGGKGVFRPRELVGNLMDYDPPEHTRLRRL
LAPGFTHRKIRRMAPYIEQIVTERLDEMEREGSPADLIELFADEVPGPVLCELLGVPR
DDRAMFLQLCHRHLDASLSGRRRAAAGEAFSRYLVTMVARERKDPGDGLIGMVVAEHG
DTVTDEELRGVCVQMMLAGDDNISGMIGLGVLALLRNPEQIAALRGDVPAAERAVDEL
IRYLTVPYAPTPRTAIEDSTVGDQVIKAGETVLCSLPTANRDPALLPDADRLDVTREA
VPHVAFGHGVHHCLGAALARLELRIAYTALWRRFPDLRLADPDGATEFRLSTPAYGIS
RLMVTW

CYP165B5   Streptomyces lavendulae
           GenEMBL AF386507 42222..43493
           complestatin biosynthetic gene cluster
           58% to 165B1
           note = ORF11; comO2
MPQQAQRQAPQQQPRAQQAYPELLYTRRTRFDPADDLRAAPPLS
RYVIGPNESDEWVWLATGYTEVRRILGDHTNFSTRRRWGAEGPNWRPPELVGHLMDYD
PPEHTRLRQMLTPEFTVRRLRRLEPDITAIIEEHLDTVEATGPGADLMPLFAQPVPGE
VLCELIGVPRDDRPEFLRHCHRHLDFSRSRKVRAADGAAFSRYLVSMVARQRKDPDDG
FIGALVREHGDDFTDEEMRGVCVLLILAGIDNIEGMIGLGVLAMLENPDQLPLLLGER
DSTGGPGAGKGDGGRLASDRALDELIRYMSVANAPTPRTAVNDVRIGDQLIKAGETVI
CSLTMANRDPALTDGPDRLDLAREPVAHVAFGHGVHHCLGAALARTELRIAYKALWRR
FPELRLAVPVEEVRFYNRALAHGVHRLPVAW

CYP165B6   Actinomadura sp. ATCC 39727 
           GenEMBL AJ561198 complement(21025..22221)
           gene = dbv12
           gene cluster for biosynthesis of
           glycopeptide antibiotic A40926
           function="cross-linking of amino acids 4 and 6"
           84% to 165B2
MSGDGARPLHTRRQDLDPADELRAAGTLTRITIGSGADAETTWL
ATGYTVVRQVLGDHRRFSTRRRWNERDEIGGRGNFRPRELVGNLMDYDPPEHTRLRQK
LTPGFTLRRIRRLKPYIEQIVTERLDALERAGPPADLVELVADEVPGAVLCELIGVPR
DDRAMFMQLCHGHLDASRSQKRRAAAGAAFSRYLLAMIARERKDPGEGLLGAVLAEYG
DTATDEELRGFCVQVMLAGDDNISGMIGLGVLALLRHPEQIAALQGDDQSADRAVDEL
IRYLTVPYAPTPRVAMEDVTIGGQVIKEGETVSCSLPMANRDPALLPDAGRLDVRREP
VPHVAFGHGVHHCLGAALARLELRTVYTALWRRFPTLRLADPDREPSFRLTTPAYGLT
SLMVAW

CYP165C1    Amycolatopsis mediterranei 9.9kB DNA 
            Y16952 CDS 2795..4015 gene="oxyC"
            90% to AJ223998 gene 1 89% to U84350 partial 
            47% to AJ223999 32520..33740
            47% to Y16952 CDS 1449..2645 40% to AJ223999 CDS 31325..32500

CYP165C2    Amycolatopsis orientalis hypothetical 
            U84350 CDS  <1..935
            92% to AJ223998 gene 1 new family

CYP165C3    Amycolatopsis orientalis cosmid PCZA363.
            GenEMBL AJ223999 region 33791-34244 incomplete
            This gene continues on AJ223998
            van Wageningen,A., Kirkpatrick,P., Williams,D., Harris,B.,
            Kershaw,J., Lennard,N., Jones,M., Jones,S. and Solenberg,P.
            Sequencing and analysis of genes involved in the 
            biosynthesis of a vancomycin group antibiotic
            Unpublished

CYP165C4    Amycolatopsis orientalis 
            GenEMBL AF486630
            Zerbe,K., Pylypenko,O., Vitali,F., Zhang,W., Rouset,S., Heck,M.,
            Vrijbloed,J.W., Bischoff,D., Bister,B., Sussmuth,R.D., Pelzer,S.,
            Wohlleben,W., Robinson,J.A. and Schlichting,I.
            Crystal Structure of OxyB, a Cytochrome P450 Implicated in an
            Oxidative Phenol Coupling Reaction during Vancomycin Biosynthesis
            J. Biol. Chem. 277 (49), 47476-47485 (2002)
            OxyC
            93% to CYP165C2 83% to CYP165C3
MGHDIDQVAPLLREPANFQLRTNCDPHEDNFGLRAHGPLVRIVG
ESSTQLGRDFVWQAHGYEVVRRILGDHEHFTTRPQFTQSKSGAHVEAQFVGQISTYDP
PEHTRLRKMLTPEFTVRRIRRMEPAIQSLIDDRLDLLEAEGPSADLQGLFADPVGAHA
LCELLGIPRDDQREFVRRIRRNADLSRGLKARAADSAAFNRYLDNLLARQRADPDDGL
LGMIVRDHGDNVTDEELKGLCTALILGGVETVAGMIGFGVLALLDNPGQIELLFESPE
KAERVVNELVRYLSPVQAPNPRLAIKDVVIDGQLIKAGDYVLCSILMANRDEALTPDP
DVLDANRAAVSDVGFGHGIHYCVGAALARSMLRMAYQTLWRRFPGLRLAVPIEEVKYR
SAFVDCPDQVPVTW

CYP165C5   Streptomcyes toyocaensis strain NRRL 15009 
           GenEMBL U82965 AF039028
           complement(6312..7490)
           70% to CYP165C3
MRRTLCDPHEDMFALRAHGPLIRIEGNASDQMSTDYVWQAMGYD
VVRKILGDHENFTTRLRLTDAQPLSGEGVSVPPELAGQISIYDPPEHTRLRRMLTPEF
TVRRIRRLEPAIEGIIEEHLDALEGAGPPADLQVLFADPVGGETLCELLGVPRDDRNE
FIRRVRQNVDLSRGYKARAADSAAFNRYLMTLITRQRKDPDEGFLGMLVREHGDRITD
EELKGVCTALILGGVESVAGMIGFGVLALLEHPDQRRLLFGSREEADRLVNELLRFLS
AVQQPTPRMAVRDVVVEGQLIKAGEYVLCSILMANRDEGLTSDSHLLDANREPLPHVA
FGHGIHHCIGAAVARAVLRITYQSLWRRFPRLSLAVPAGEVKFRNAFIDSPDRLPVTW

CYP165C6    Actinomadura sp. ATCC 39727 
            GenEMBL AJ561198 complement(19681..20943)
            gene = dbv11
            gene cluster for biosynthesis of
            glycopeptide antibiotic A40926
            function="cross-linking of amino acids 5 and 7"
            76% to 165C5
MRIDSEWSFDPGMDDDIDAGAPVLQPTANYMMRTHCDPHEDMFA
LRAHGPLVRIGGDAATQLRVDYVWQALGYDVVRRILGDHENFTTRPRWSSAPSIAGEP
IPPNLVGQLSVYDPPEHTRLRGMLTPEFTARRIRRLEPAMQDLIDDRIDELEAAGPPA
DVQALFADPVGGGVLCELLGIPRDDRIEFIRRVRQNVDLSRGFKARAADSAAFNRYLN
GLIIRQRKDPDEGFIGMLVREHGDDVTDEELKGVLTALILGGVETVAGSIGFGVLALL
DHPDQRQSLFAGREEADRVVGELLRFLSPVQQPNPRLAVRDVVVDGQLIKAGDYVLCS
ILMANRDEALTPNANVLDVRRDCGSHVGFGHGIHYCIGAAIARTLLRMAYQSLWRRFP
GLRLAVSAEEVKFRNAFIDCPDELPVTW

CYP165D1   Streptomcyes toyocaensis strain NRRL 15009 
           GenEMBL U82965 AF039028 complement(10263..11417)
           45% to CYP165A3
MALPLPHRRHRLDPVPEFHDLQNEGPLHEYDTEPGMDGRKQWLV
TGYHEVRDILADPERFSSMRPVDDEADRALLPGILQAYDPPDHTRLRRTVAPAYSARR
MERLRPRIEEIVEECLDDLEDVGSPVDFVRYAAWPIPALIACEFLDVPRDDRAELSRM
IRESRESRLPRQRTSSGMGVVNYTQKLAARKRLDPGEGMIGVIVREHGAEVSDEELAG
LAEGNLIMAAEQMAAQLAVAVLLLVTHPDQMALLREHPELVDGATEELLRHASIVEAP
APRVALEDVSVAGRDIRAGDVLTCSMMAVNRPQGEHFDITRENPKHMAFGYGIHHCLG
APLARLQLRVALPAVLRRFPSLRLAVPEEDLRFKPGRPAPFAVEELPVEW

CYP165D2   Actinomadura sp. ATCC 39727 
           GenEMBL AJ561198 complement(22211..23365)
           Gene = dbv13
           gene cluster for biosynthesis of
           glycopeptide antibiotic A40926
           function="cross-linking of amino acids 1 and 3"
           75% to 165D1
MVVPLPHQRLRLDPVPALFDLQEDGPLHEYDTEPGLDGHKQWLV
TGYGEIREILADANRFSSMRPVEDEAERAWLPGILQSYDAPDHTRLRRTVTRANTARR
IESLRPVVEETVEDCLADLESMGSPVDFVRNAAWPIPALIACDFLGVPRDDQAELSRM
FRDSRESRVPRQRNVSGLGIVDYARKLAARERLDPGTGMIGGIVREHGGEVTDEELAG
LVEGIMIGAVEQMASQLAIAVLLLVTHPDQMALLRERPELADSAAEEVFRYASIVETP
SPRTALVDTRLAGRDIHAGDVLTCSILAGNRAREDRFDLTRGNPEHLAFGHGVHFCLG
APLARLQAQVALPALVRRFPSLRLAVPAEDLRFKPGKPAPFAVEELPVEW

CYP165E1   Streptomyces lavendulae
           GenEMBL AF386507 41015..42208
           complestatin biosynthetic gene cluster
           45% to 165B1
           note = ORF10; comO1
MASRDVPVYNRRDRLDPVPELVELRNRCPVLRTELHGGPSSQVV
GWLVTGIDESREVLSDQHRFTMLPPADTEAQSRRLQNIGNPLHYDPPEHTRLRKMLNP
EFTMRRLRRLQPRIDAVVEECLDAMEQAGAPADLMQHFAWQIPGHTACELLGVPRDDR
AELSRHLDITRDDGRGRARQMAAGRAYRAYFHQLTARQRRDPGDDLLGMLVREYGDEI
TDEELEGLAASLTSAGIENVASMLGLGTLVLLEHPDQLAELREKPELIDRAVEELLRH
VSVIPTLSPRTALEDVPLGGHVVPKGERVICSAFAANRIATPGDDLEDGFDITREPAP
HMAFGHGVHHCLGAPLARMQLRTAYQALWRRFPELRLAVPHEEIRFRMPSSRVYSVDA
LPVAW

CYP166A1       Amycolatopsis mediterranei rifamycin.
               AF040570 CDS 2652..3842 identical to AJ223012
               similar to Streptomyces Sp. ChoP" 
               probably a new family 41% to 105C1 but less to other 105s

CYP166B1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           46% to 166A1
           clone name SP0879

CYP167A1     Sorangium cellulosum = Polyangium cellulosum
             AF210843 CDS 62369..63628 gene = epoF
             35% to 107B1 new family

CYP167A1     Sorangium cellulosum = Polyangium cellulosum
             GenEMBL AF217189 56757..58016 
             epothilone gene cluster
             gene = epoK
             note = P450 epoxidase

CYP168A1     Pseudomonas aeruginosa
             NC_002516 complement(2792798..2794132)
             locus_tag = PA2475
             35% to 107P1
MDDAFSEEGSAQPRHDAQRPALAPRSDGFDIHTYHPDFVADPYP
LLRLIRSRAPVCRDQASIWWISRYADVSACLRDRRFSADPARLGAAGVRQGGASWFGH
QQLQPLARFYDNFMLFNDAPRHTRLRRLFAPAFGPDAVRRWEARIEVLVEELLDSLLE
RREPDLLRDFAEPLTIRVAAELFGFPREDTGQLLPWGRDLAAGLDLAASHGDAGQINR
SAVAFSDYLQRQARGWSDGSSRPPSGAAPSILDGAAMLEAGLGLEDLVAAYAMVFMAA
FETTISMVGNATLALLTHPDQLDLLRRCPELAANAVEELLRFDGAVRGGVRCTLEEVE
IGGQRIPPGEKVWLSFLAANRDPEMFAAPDRLQLQRANAKQHVAFAHGPHYCLGAYLA
RLELQCALRGLVRRRFALASEPTDLRWRRSSVFRTLERLPIVPEGDAQKTCE

CYP169A1   Pseudomonas aeruginosa
           NC_002516 complement(4121113..4122390)
           locus_tag = PA3679
MQQTIDCPIRRRLAHLPWANDGRAGVRHWLEMQRDPLAWLQKMH
VAQPDLAVARMGPQRLWCLFHPQAVQELMVDRRDDLQRWQPALCMLKQWNGRSFMMRE
GAPAQARRKEVRPHLAPPPASEVRRLAAEWGERVEEGREYDLDLEMAAFSVTLSGHAL
FDVDLQPSAYRIAKAVRLLSRVALLEMSTGLPLGHWFPSKLCPRKRWALGQLREAVGE
VAERSPRPLADLRDELCTLLMASHQSTGVTLTWSLLLLAQRPELLARLRAELAGVNWT
AIRSVADLRDCALLRAVLQECLRLYPPAYGLAPRQVTADIEVFGQRLKRGDVTMVSSW
ITQRDPRWFEAPLEFRPERFLEPARWPRGAYFPFGLGDRACPGTAMAMIDLAAALAYW
VEHWDIMHDGDLAPRGWFSLRPQRARVRFRRRA

 CYP170A1 Streptomyces coelicolor cosmid 7E4 gene="SC7E4.20
         GenEMBL AL359214 CDS 18278..19663
         32% to Streptomyces avermitilis CYP171A1
         cloned and expressed by David Lamb and Steve Kelly

CYP170A2   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV3031 79% to CYP170A1 from Streptomyces coelicolor

CYP171A1 Streptomyces avermitilis polyketide synthase gene cluster 
         GenEMBL AB032367 CDS complement(31914..33284)
         gene="aveE"
         note="probably catalyzes furan ring formation at C6 to C8
         32% to CYP170A1

CYP171A1   Streptomyces avermitilis
           GenEMBL AB032367 CDS complement(31914..33284)
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV941_aveE see above entry

CYP171A2    Streptomyces nanchangensis
            GenEMBL AY129009 
            complement(2614..3993)
            MeiE; involved in meilingmycin biosynthesis
            62% to 171A1
MPAPLQVPDVPGSWPVVGHLPQLARRPLDFLSSLADHGDLVRIR
LGRKPVYVATHPDLVRSLLVTDAHAYTRGAGHAKALAFIGPILVATTGEPHRRQRRMM
QPCFHRQRLGSYVSAMCSAATETADSWSAQDVVDVVPVMTELATAMIAKSLFVSERAA
HAEAELRKTGNAILTVARMSAILPGIYRRLPTPGNRQLPPARTVIEETIAAYRAEGQD
HGDMLSTLLRTTDATGTGLTDEEIRDEVMGLAITGIGGPAAIASWIFYELGQNPDLER
RLHEELDTVLDGRPPSSQDLTRLVFTQRLVKEALRKYPGWVGARRTRESVRLGGHEIP
ADAEVMYSAYALQNDPRWYPDPERFDPDRWDPQQNATRVKKGAWVPFSGGVYKCIGDA
FTETETAVAVAVIASRWRLRPADGRSVRASHLATHVVPRPLRMVVEPRSRNKDEAERS
PHEAPQVSR

CYP172A1   Campylobacter jejuni 
           GenEMBL AL139078 comp(120285-121649)
           Parkhill,J., Wren,B.W., Mungall,K., Ketley,J.M., Churcher,C.,
           Basham,D., Chillingworth,T., Davies,R.M., Feltwell,T., Holroyd,S.,
           Jagels,K., Karlyshev,A., Moule,S., Pallen,M.J., Penn,C.W.,
           Quail,M., Rajandream,M.A., Rutherford,K.M., VanVliet,A.,
           Whitehead,S. and Barrell,B.G.
           The genome sequence of the food-borne pathogen Campylobacter jejuni
           reveals hypervariable sequences
           Nature 403 (6770), 665-668 (2000)
           only 28% to 102A3 

CYP172A1   Campylobacter jejuni subsp. jejuni NCTC 11168
           GenPept CAB73835                 
           100% match
  1 MSECPFFPKP YKNKASTLLT FLLKRRSWLD GLYERSYKMQ TGYVKMPNFD LYVINDTKEV
 61 KRMMVDEVRE FPKSAFLHEL LSPLLGESIF TTNGEVWKKQ RELLRPSFEM TRINKVFNLM
121 SEAVADMMDR FSKYPNHAVI EVDEAMTFIT ADVIFRTIMS SKLDEEKGKK ILNAFVTFQE
181 QSVHTAMRRM FRFPKWLSYV LGDCKRAKAG DVIRQVLSDI IKPRYDMADN AEFEDILGSL
241 LLVVDADTNK RFSFEEILDQ VAMLFLAGHE TTASSLTWTL YLLSLYPKEQ EKAYEEITQV
301 LQGGVIEISH LRQFKYLTNI FKESLRLYPP VGFFAREAKK DTQVRDKLIK KGSGVVIAPW
361 LIHRHEEFWT NPHGFNPSRF EGEYKKDAYL PFGVGERICI GQGFAMQEAI LILANILKTY
421 KLELEEGFVP DVVGRLTVRS ANGMRIKFSK RKL

CYP173A1   Mesorhizobium loti 
           GenEMBL AP003005.1  327049-328782 
           only 30% to 172A1 

CYP173A1   Mesorhizobium loti
           GenPept NP_105897
           NC_002678 complete genome 4126331..4127698
           100% match
  1 MDTQPAPFVP PAPKPRTSPP STLEMIRIVY RNPLELWGEP TYNEPWISAN GVGGHLIVAN
 61 DPGLIRHVLV DNAKNYKMAT VRQKILRPIL RDGLLTAEGE VWKRSRKAMA PVFTPRHIFG
121 FAQPMLKRTK EFVTRYEEGG ASDIAHDMTL LTYDILAETL FSGEIAGEPG SFANEIDRLF
181 ETMGRVDPLD LLRAPDWLPR LTRIRGRKTM AYFRKIVTDT VKMREEKFRR DPDAVPQDFL
241 TLLLKAEGPD GLTRSEVEDN IITFIGAGHE TTARALGWTL YCLAESPWER NRVEQEIDEV
301 LAREPDPTKW LDAMPLTRAA FDEALRLYPP APSINREPIE PEMWKDLYIP RHAAVLVMPW
361 VVHRHRKLWD RPDAFLPERF HPGNREKIDR FQYLPFGAGP RVCIGASFAM QEAIIALAIL
421 LSRFRFDTTA ETKPWPVQKL TTQPQGGLPM QVTPR

CYP173A2   Sinorhizobium meliloti 1021
           Genpept CAC41447                 
           NC_003047 65218..66618 = 173A2
           locus_tag = SMc02579
           62% to CYP173A1 Mesorhizobium loti
MDTRPEPFEPPAPVPRTGIPSRLEIIRTVLRNPLELWGEPSYTL
PWIETKFINQRTLIVNDPGLIRYILVENAANYEMSNVRRLILRPILRDGLLTAEGEVW
KRSRKAMAPVFTPRHAQGFAGQMLRVCEAFVDRYAGASSEPFVTNVAVDMTELTFEIL
AETLFSGEIAVEKQGFAANVEELLHRMGRVDPMDLLVAPSWVPRLTRIGGRKVLDRFR
GVVSETMSLRRRRTTEAPGDVPNDFLTLLLQLEGPDGLSTSEIEDNILTFIGAGHETT
ARALAWCFYCVANTPAYRETMEQEIDSVLASGADPVDWLGRMPHVLAAFEEALRLYPP
APSINRAAIEEDAWTSPEGERVPIRKGISVLVMPWTLHRHALYWQKPRAFMPERFLPE
NRDKINRFQYLPFGAGPRVCIGATFALQEAVIALAVLMHRFRFDLTDETHPWPVQRLT
TQPRGGLPMKVSARVK

CYP173B1    Magnetospirillum magnetotacticum
            GenEMBL AAAP01002719 
            42% to 173A1 missing N-term 91 aa
1466 NGLLTAEGDEWRLQRRTLAPIFSARHVAGFVAQMDAAGARLGRRLARRDGATVDIALEMT 1287
1286 RATLDVLERTIVHAKGLPGPIPDALGRAITRLLESVGPIDP 1164
1185 SDVFGFPAFVPRLGRLRAGRHCVSSRRW*HLLDGRKQALARGEAPHDLM 1015
1014 TLLLAAQDPETGRGLSDIEVKANIVTFIAAGHETTANALTWALYCLSQDGAARARVEAEA 835
 834 DAAAGPEGNLRLDRLPFTKAVMEETMRLFPPVPFLSRQALRDDRIGRVKIPRNSTVIV 661
 660 APWVMQRHRKLWDEPDAFIPDRFFGSRRESIERYAYLPFGAGPRVCIGQSFSVQEATLVL 481
 480 AHVARAVRFTLPDEHPPVTPLHRVTLRPKDGLRMVARRRM* 358

CYP174A1   Halobacterium sp. NRC-1 
           GenEMBL AE004998 comp(560-1777) 
           only 33% to 171A1 

CYP175A1   Thermus thermophilus
           GenEMBL AB001637 N-terminal 30 amino acids only 1587-1677
           AX451783 full seq
           Francesca Blasco francesca.blasco@po.uni-stuttgart.de
           Full sequence submitted to nomenclature committee 9/17/2001
           Crystal structure known

CYP176A1   Citrabacter braakii
           GenEMBL AF456128
           David Hawkes and James De Voss, University of Queensland, Australia
           Full sequence submitted to nomenclature committee 11/15/2001
           P450cin involved the hydroxylation of cineole

CYP177A1   Rhodococcus rhodochrous
           No accession number
           Helena Seth-Smith
           submitted to nomenclature committee 7/30/2002
           degrades an explosive to confer RDX degrading phenotype
           alternative name XplA (for explosive gene A)

CYP178A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV838

CYP179A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2061

CYP180A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2165

CYP181A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2385

CYP182A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2806

CYP183A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV2999

CYP184A1   Streptomyces avermitilis
           No accession number
           Submitted by David Lamb and Haruo Ikeda 9/3/02
           Clone name SAV5111

CYP185A1   Streptomyces tubercidicus strain I-1529
           No accession number
           Istvan Molnar, Syngenta Biotechnology, Inc.
           Submitted to nomenclature committee June 2, 2003
           Clone name CypLB
           Low 30% range to other bacterial P450s

CYP186A1   Nostoc sp. PCC 7120 (cyanobacteria same as Anabaena)
           GenPept BAB73318                 
           NC_003272 complete genome complement(1615917..1617470)
           24% to 172A1
  1 MLQYITAQID NSSSFPYLVT VLSVTTIAGT FAWRWWKQKK KYKSLQSLPS PPKHWLLGNL
 61 PQVLAAVKQK KLFQLFFDWS QQLGPMYVVW NGSSPVVILS KPKVIEDTIV NGMRDGSLIR
121 SARLRQAWND ISGPILIGET GNEWQWRRKV WNPEFSSSSL AKYLKIINQA CVQVIDTLKE
181 TALPKEVEVD PLFVELTMRV ISSLVLGIPV DRKITTNEGP PLEVLKVYEA MCVVGYRFLR
241 QATGEKIWMK YLPTKNSQDY WASRRYLEEF LTPRVDLALQ MREQSTDFPQ VSPLFRESML
301 VRIAAKEPKY NRQTLIAESV EFLIAGTDTT AHTLSFAVGE LSLNPRVFQK AREIVDQAWQ
361 GQDNINTESF KELAYISAIL KETLRLYSIA SGSTSLEAQR DTVIEGKVIP SGTRISWSML
421 AAGRDPEVYA NPEEFLPERW LDKSKETSSL PMIDFGSGPH RCLGEHLSML EGTMMLALLL
481 RHFDWELVNG RSSLEQLQQN LLIYPSDKMP VRFRLRN

CYP186A2    Nostoc punctiforme
            GenEMBL NZ_AAAY02000016.1 
            complement(17366..18917) gene = Npun4356
            77% to 186A1
MFQQIAAQITFSDSFPYLVTALGITSTAGIFGWRWWKQKNTYKS
LQSFPSPKRHWLLGNIPQVLAAVKEKKFFQLLFDWSQQLGPMYVYWTGFP
18635 VLVLSKPKVIEDTIVNGMRDGSLIRSQRASKAWNDIGGPILLGQNGSEWQYRRKAWNPEF 18456
18455 SSSGLSKYVEIINQACEQIIEKIQSVASPEVQVDPLFVELTMRVISCLVLGIPVDKN 18285
18284 IATNEGQPLDVLKVYEAMSIVGYRFLRVATGEKIWMKYLPTKNSRDYWAARRYLEEFIT 18108
18107 PRVDLALQMREQNQTDLTQVSPLFQESMLVKIAAKEPKYNRETLVAEVIELLIA 17946
17945 GTDTTAHTLSFAIGELALNPRVFHQAQAVVDQVWESQGTINGESLKELNYIRAILKETLR 17766
17765 LYSDDS 17748
      XXXSLXAQR
      DTVIEGTVIPRGTKIYWSMLAAGRDPEVYSHPDEFLPERWLEKGKEN 17579
17578 SQLPMIDFGSGSHRCLGEHLSMLEGTMMLALLVYYFDWELVNGRSSLEQLQQNLLIYPPD 17399
      RMPVRFRLRK* 17366

CYP187A1   Deinococcus radiodurans
           GenPept AAF11281   
           GenEMBL NC_001263 complement(1748793..1750130)
           Gene = DR1723
           25% to CYP120
  1 MVPAPPFLGH AAEMGTIKLR PFLTRCYQAY GPVFQLTVPG QKITVLAGPE ANLFAMKEGH
 61 RVLRSLEAWR DNDHEMGSDR SMISLDGAEH RAYRRVEGRA FARSFFAAGL RPALAVLAED
121 LAPFQPGDVL PVATWCKKTI TEQLARMAVG GTVRPYLPDL LHFIQTALQV TVNRQLPPAV
181 LRLPKYRRAK ARIFQMVDDL IEDHRQNPPE KSGRAPDLID DVLADQQVNP ERWEHPDVRL
241 AALGAFIAGM DTAANSLAFV LYRMHLHSEF LPALRAEADA LFRDGPPTAE ALGRSPLLHR
301 FVMETLRVHP IAPALSRTLT EDVEFAGHRI PAGTPVIIGT TVPHGLPELF PDPEHFDPGR
361 FAPGRAEHRQ PGAYAPFGVG SHTCAGSGMA EGLIMLGAAA ALRTLDLSLE PDYVLRQTAK
421 PTPSLDNKLQ LRVNAVRHNP VFLVH

CYP188A1   Deinococcus radiodurans
           GenPept AAF12016, F75270
           GenEMBL NC_001263 2469804..2470949
           Gene = DR2473
           30% to 175A1
  1 MLSSLHDLPE PASRPGSGHL QDWAARPLAL IEEGATQALA AGQDLFRLRL GLPAVVGLSP
 61 AWNRRVLTDL NTFVSAGSFS AVVPYLAGGV ILTDAPGHGA RRRALNPGFG KGSVQQLRER
121 MRQASSPVPT GRFNALAWAD ETVRRQLNAA YFASEFDDRL LAAFLAPLRR PFPVPALPRP
181 LLFRRVEQEI RRLAERRLRE GGDDLLSTLA PLPGGLLETR ISLAAAHDTT THALAYAVWE
241 LAKAPQDQTP HTHSAVLKEV LRLYPPGWMG SRRLSRAAEW QGTEIPRGTL ALYSPYLTGR
301 DPTLWERPLD FRPERWEKSP PAWAYLPFGG GERTCLGVHL AQTLILDVLA ELPPLQAHWG
361 NDEPHPGITL GPRGPLVVER R

CYP189A1   Corynebacterium efficiens YS-314
           GenPept BAC17372                 
           35% to CYP116 82% to CYP189A2 NP_599791
  1 MIHNMETRCG SYHRATGILT GDDMTSDSTT ALSTAPETTS GGCPYGHGNP DATGTPGTSH
 61 HGYEPFNMTN PFPAYEELRR EEPVMFDERI GYWVVTRYDD IKATFDDWET FSSENAQAPV
121 RKRGPQATKI MEEGGFTAYS GLSARIPPEH TRIRAIAQKA FTPRRYKALE PDIRANVVAR
181 LETMLKQGAP ADIVPALAYD IPTITILTLI GADVSMVDTY KRWSDSRAAM TWGDLSDEEQ
241 IPHAHNLVEY WQECQRMVAD AHANGGDNLT ADLVRAQESG QEITDHEIAS LLYSLLFAGH
301 ETTTTLISNC FRVLLAHRDQ WEALIEDPKK IPAAIDEVLR YSGSIVGWRR KALRDTEIGG
361 QPIKKGDGVL LLMGSANRDE ARFDDGETFD ITRPNAREHL SFGFGIHYCL GNMLAKLQAK
421 ICLEEATRLV PSLELADDQS VEFRENLSFR VPVSVPVTWS N

CYP189A2   Corynebacterium glutamicum ATCC 13032
           GenPept NP_599791  
           35% to CYP116 82% to BAC17372
  1 MTSQTSQQST STGGCPFGHT SESTSHHGYQ PFDMHNPFPA YKELRQEEPV MFDERIGYWV
 61 VTKYDDIKTT FDDWETFSSE NAQAPVRKRG PQATQIMTDG GFTAYSGLSA RIPPEHTRIR
121 AIAQKAFTPR RYKALEPDIR AMVIDRVEKM LANDQHVGDM VSDLAYDIPT ITILTLIGAD
181 ISMVDTYKRW SDSRAAMTWG DLSDEEQIPH AHNLVEYWQE CQRMVADAHA HGGDNLTADL
241 VRAQQEGQEI TDHEIASLLY SLLFAGHETT TTLISNCFRV LLDHPEQWQA ILENPKLIPA
301 AVDEVLRYSG SIVGWRRKAL KDTEIGGVAI KEGDGVLLLM GSANRDEARF ENGEEFDISR
361 ANAREHLSFG FGIHYCLGNM LAKLQAKICL EEVTRLVPSL HLVADKAIGF RENLSFRVPT
421 SVPVTWNA

CYP190A1   Brucella melitensis 16M
           GenPept AAL54121    
           PUTATIVE CYTOCHROME P450 YJIB
           31% to CYP145
  1 MRAGGIMTSP TERPKQDWDP RSEAVLSDQI GAYDAMRHQC PVAHSDYLGW SLFSYDDVVR
 61 VLDDHETFSS VVSAHLSVPS GMDPPQHTAF RQLVERYFEP ERIKAFEPIC REISKKLVCE
121 LPRDAEIDLV TQFAQLYAVR IQCAFLGWPD SLQGPLLDWV HKNHAATLAR DTKAMAAIAL
181 EFDEYIRDLL DERRKLGADA PDDVTTRLLR DRIDRRNLTH EEIVSILRNW TVGELGTITA
241 CVGILCHYLA KSQQTQALMR GGPDLLPAAI DEILRLHAPL ISNRRVTTRA VVVGGREIPA
301 GEKITLMWAS ANRDEAVFDK PDELRLNRDP ALNLLYGRGI HVCPGAELAR AGLRILMEEL
361 LGQTRKLDLV PGSVPALAVY PASGFSRLPA RIS

CYP191A1   Caulobacter crescentus CB15
           GenPept AAK22930  
           NC_002696 complete genome 1051211..1052545
           34% to CYP180A1
  1 MDLISQTVVD GKAGPGAPPT YPTLKDVDLA DIFRFTKGQP WADFARMRQE APVMWHPEPM
 61 GGPGFWALTR YEDVHRVNGD PETFSSQRGG ILMSMGAPEK RHALLFRASM DTMINMDAPH
121 HLQLRREHMP YFTPSYLRGL TERVKGEVTR LLDEMEPLLA NGAEIDMVEH FSSVLPLFTL
181 CEILGVPPED RPKFLTWMHY LERAQDLAVK QANAPMQPTL ELMQFVMDFN NNVEEMFEYG
241 RTMLHKRRED PKEDLMTAIA RAQLDGAVLP DEYLDGSWLL IVFAGNDTTR NTLSGAMRLL
301 TEFPDQKQKL IADPSLLGGA VDEFIRMVSP VVYMRRTATR DVEVNGQLIR EGEKAIMYYG
361 AANRDPAMFE NPDQLDVTRA NAGKHIAFGY GPHTCIGKRV AQIQLEEAYR QILARFPDLN
421 WTGNIEIAPN NFVHAISKLG VKRG

CYP192A1   Caulobacter crescentus CB15
           GenPept AAK24959, C87620
           NC_002696 complete genome 3214816..3216192
           35% to 173A1 40% to BAC45822
  1 MDADVRSAPL IPPAPKVHPR QLGGSFVGEL RIALEMSRNL MGAWCEEDFD NLFTPYVFMG
 61 QPGMVVSDPA AARRILSSPN YVRPVKAARS VRPIAGDGLL LSEGETWRRQ RKSLAPVFTP
121 MAVEGLLPHF VAAGASLAEA LSGHARADLS EAFHHATLDA VLSALFSRRA DAQGDQLAYM
181 VRRYMEGPAH FNLMDFVSRG ADDLTFLDVE RRRQGAAWFQ AVEHLIAQRQ AHPHAEARDL
241 LDRLLAARDE DGAPLSNQEI RDQCGTMLVA GFETTSRLLF WATYLLALDP ATQDRLRAEV
301 LAAPAAAVRT LDDLQAWPLM RSVLFETLRL YPTAPLLARE AIGPDTVMGH AVVPGQIITI
361 SPWLIHRHRK LWDAPTAFVP DRFIDQPHPW GIEAFLPFGA GPRVCIGASF ALAEAQIVLA
421 SLLERFEIGL VSDRPVIPIA SITLGPDHAP AFTLTPVS

CYP193A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC52277    
           NC_004463 complete genome complement(7721594..7723027)
           33% to 104A2
  1 MARGCASRCS RPVSDASPAP RAGTLSGARL ECRLCRFMAL DERCLCVCRC PLLWVMRTRY
 61 RARTPCPNRW GQTAAPERAS LAGHSRETAL STAPRIDIDP AAFWADPYPM LANMRKEAPI
121 AFVPQLGSTL LTSRDDISIS EKQIDVFSSH QPAGLMNRLM GHNMMRKDGE AHQVERRAMF
181 PTVSPKTVKG YWTALFQAHA DRIIDAIEPG RIDFMRDFAL PFSGECLKSI TGLTNIGFAE
241 MDAWSQGMIE GIANYVGDPA VEARCHAATS GIDAAIDDML PVMRKNPDQS ILGVLLASGM
301 PMESVRANVK LAISGGQNEP RKAIAGTVWA LMTHPEQLDL VRRGEVTWLQ AFEEYARWIS
361 PIGMSPRRIA KPWSIRDVAF ELDERVFLMF GSANRDEKHF ERADQFDVRR DTSKSVAFGA
421 GPHFCAGAWA SRAMIADVAL PTLFARAGRI EIADDEPVRI GGWAFRGLQN LPARWLH

CYP194A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC48170        
           NC_004463 complete genome complement(3198120..3199340)
           36% to 176A1
  1 MSDVSEPVAH PPVTDWVNDF DHTDPQWTDD PFPIWDELRA ASPVVHTERF LGCYMPTTYE
 61 AVREIANDTE HFSSRRIIVR DVRPEIARNA APPITSDPPV HKPAKQLLLP PFTPDAMKKL
121 EPRVRTICNE LIDGFISDGK VDAAARYSKY IPVRAIAHML GIPESDSDLF VNWIHMILEL
181 GIKDETMLLQ AVQEMSAYFR THIEERRSRP TDDLISYLMN AKDKEGQPLE ESHVLGSLRL
241 LLIAGIDTTW SAIGSSLWHL ARTPADRERL IAEPGLIPIA VEELLRAYSP VTMAREVVKE
301 TTISGCPVKA GNMVLLSFPA ANRDPKMFPD ADKVVIDRRE NRHAAFGLGI HRCVGSNLAR
361 MEMQVALEEW LKRIPDFRLD PAGTVTWSQG TVRGPRQLPF LLGKAM

CYP194A2   Rhodopseudomonas palustris
           NZ_AAAF01000001 
           complement(3427752..3428951) gene = Rpal3007
           74% TO 194A1
MSERAPVTDWVNDFDHTDPRWTENPYPIWDELRSAGPLVHTDRF
LGCYMPTTFAAVKEISYDTDHFSSRRVIVRNVRSESPPPAPPITSDPPEHKPAKRLLL
PPFTPDAVAKLEPRVRAICNELIDAFIEDEGCDAATAYTKHIPVKTICHMLGIPEDDS
DIFIRWIHEILELGINDDAILMKAVFEMSTYFQGHIAHRKQKPTDDLISTLMNARDDK
GQPLSDAHVLGSLRLLLIAGIDTTWSAIGAALWHLATHPADRERLLAEPELMPTAIEE
FLRAYSPVTMAREVMKETSIAGCPVKPGNMVLLSFPAANRDPSVFPEADRVMIDRKEN
PHVAFGLGIHRCVGSNLARMEMTVAIEEWLKRIASFRLDPSQKVRWSEGTVRGPRSLP
LLFGKPS

CYP195A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC48121     
           NC_004463 complete genome complement(3142651..3143883)
           34% to 107P2 37% to BAC51802
  1 MNADAKELAA SFDLEKLTPE FYDNPYPTYR ALRENEPVKR LPNGTVFLTR YDDLVTTYKN
 61 TKSFSSDKKR EFAPKYGNTP LYEHHTTSLV FNDPPAHTRV RRLIMGALSP RAIAGMEADL
121 IKLVDGLLDA IAAKGSCELI EDFAASIPIE VIGNLLDVPH DERTPLRDWS LAILGALEPV
181 VSPEAAARGN KAVKDFLSYL ETLVARRRGK PGNPERDVLT RLIQGEGNGE ENGERLTEKE
241 LLHNCIFLLN AGHETTTNLI GNGLVALDRH PDQKQRLIDH PDMIKTAVEE MLRYESSNQL
301 GNRMTTERVE LGGVMLDAGT SVTLCIGAAN RDPAQFPDPE SFDIARTPNR HLAFATGAHQ
361 CAGMALARLE VAIAISRFLA RFPNYAVNGR PVRGGRVRFR GFLSVPCAIG

CYP195A2   Rhodopseudomonas palustris 
           NZ_AAAF01000001 
           305794..307173 gene = Rpal0264
           74% TO 195A1
MSVEEAALAAGPGPPTGRMTCVAPVPAARPDPQISRPFRQRRKS
PIDVKNGNDMETAPAELAEAFDLARLTPDFYDNPYPTYHALRAHQPVKRLASGGYFLT
RYDDLVAVYKNTTLFSSDKKREFTPKYGDSLLFEHHTTSLVFNDPPSHTRVRRLIMGA
LTPRAIAGMEPDLIALVDRLLDAMAAKGRVDLIEDFASAIPIEVIGNLLGVPHDERGP
LRGWSLAILGALEPVIGPEAFALGNAAVAEFLGYLDTLIARRTAEPGDPERDVLTRLI
RGEAGGEKLTAKELLHNCIFLLNAGHETTTNLIGNGLVTLAANPDQKRRLIAEPALIK
TAVEEILRYESSNQLGNRITTAEVEIGGVSMPANTSLTLCIGAANRDPAQFADPDRFD
VSRSPNRHLAFASGPHQCAGMALARLEGAIALSRFLAHFPDYVLDGPPQRGGRVRFRG
YLGVPCRLG

CYP195A3    Burkholderia fungorum
            GenEMBL NZ_AAAJ02000119 
            3110..4828 gene = Bcep1797
            64% to 195A2
MGAAIDVEVGALGDACIGNPDRVGVDDAGVRTARQRNERFVMVG
GKGRGALNDEVHGRRRSDTVEGGRAARAANPAIVTVRRFASPRAIRAKRCCARHPAWR
RAILRRAVHTDESNDASQPPRTPTVACTPSRRAKSGTRTQRHPRRGAPLRRHRMTPAT
ASDASTLARDFDLRHLNPAFHADPYPVYHALRAHEPVKRMPDGSLFLTRFRDVQAVYR
DPKTFSSDKTVEFKPKYGDSPLYAHHTTSLVFNDPPRHTRVRKLIAGALTARAIAAME
PGLVRLVDGLLDAAAARGRIDLIDEFASAIPVEVIGNLLDVPHTERAPLRDWSLAILG
ALEPSLSEAQLERGNRAVSEFIDYLRDLVARRRREPGDPQHDVLTRLIQGEAGGEQLS
EAELLQNCIFILNAGHETTTNLIGNGLVTLTQWPEQRAALLHEPSLIESAVEECLRFE
SSNQLGNRMATVDTEIGGVAVARGTPVTLCIGAANRDPEQFADPDRFDIRRDPNRHLA
FGFGIHQCAGLSLARLEARIAIGRFVQRFPAYRVNGEPTRGGRVRFRGFAAVPVELEP
AGRRTA

CYP195A4   Stigmatella aurantiaca 
           GenEMBL AJ421825 complement(4978..6231)
           66% to 195A2
           note = ORF8
MLRSVSASRPPSPANPVAAFDLARLDDAFYADPFPLYRAMRERD
PVHRMPDGSLFLTRWADLDCIYRDTRTFSSDKRAEFGAKYGDAPLFEHHTTSLVFNDP
PLHTRVRRLIVGALTPRALSTMEPGLRTLVDRLLDGLAVKGAADLIEDFAAAIPIEVI
GNLLDIPTEERGPLRGWSLAILGALEPRLTAEQEACGNEAVTEFLDYLRILVAQRRAR
PGDPATDVLTRLIQGESDGERLTETELLHQCVFLLNAGHETTTNLIGNALELLARFPD
ERARLLRAPALIPTAVEEVLRYESSNQLGNRRVAEDTEIGGVAVPTGTFLTLCIGAAN
RDPARFEDPEHFDVGRQPNRHLAFAGGAHTCAGMNLARIEARIALAAFLARFPDYALT
APPVRARRARFRGFTAMPTRLGSLR

CYP196A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC46159     
           NC_004463 complete genome complement(972593..974053)
           36% to CYP136A1
  1 MLPRSAGAGR NKVAVARCPF GQPTGALVMS MQNVAAPALQ FTAPRRNELT HIPGDEGWPV
 61 IGKTFQVLAD PKGHIEANGA KYGPVYRTHV FGETNVVLLG PEANELVMFD QQKLFSSTHG
121 WNKVLGLLFP RGLMLLDFDE HRLHRKALSV AFKSGPMKSY LSDLDRGISA RVAQWKAKPG
181 EMQLYPAMKQ LTLDLAAASF LGADIGPEVD EINRAFVDMV AAAVAPIRRP LPGTQMARGV
241 AGRKRIVAYF RQQIPLRRGN HGGDDLFSQL CRATHEDGAL LSEQDIIDHM SFLMMAAHDT
301 LTSSLTSFIG ELAANPDWQD RLRAEVLALG LAPGAPSSFD DLEKMPLSEM AFKEALRIKP
361 PVPSMPRRAM RDFTFKGFRI PAGTAVGVNP LYTHHMKDIW PEPDRFDPLR FTEEAQRNRH
421 RFAWVPFGGG AHMCLGLHFA YMQAKCFARH FLQNIEVSLA PGYKPDWQMW PIPKPRDGLK
481 VRVKAV

CYP196A2   Rhodopseudomonas palustris
           NZ_AAAF01000001 
           complement(2360490..2361869) gene = Rpal2059
           70% TO 196A1
MSIQVADSSLVARLSPPKPSALAHVPGDEGWPIIGRTLAVLADP
KGEVEKMARTYGPVYRSRVLGETSITLLGPEANELVLFDNTKLFSSTHGWGPILGRLF
PRGLMMLDFDEHRLHRRTLSVAFKAGPMQSYLAELNAGIAHRVAEWRARPGEMLCYPA
MKQLTLDLAATSFLGTAIGAETEEVNRAFIDMVAASVAPIRKPWPGTAMARGVKGRQR
IVAYFAEQIPIRRAKGGDDLFSQLCRATHDDGALLSNQAIIDHMSFLMMAAHDTLTSS
LTSFVAALAAHPEWQQKLREEIAGLGLKPGEPISFEQLDALPLTEMAFKEAMRLRPPV
PSLPRRATRAFSFKGYTIPAGTMVAVNPLFTHHMPEIWPNPDQFDPLRFTDEASRGRH
RFAWIPYGGGAHMCLGLNFAYMQAKCFAVHLLQHLDLSLPPNYQASWQMWPIPKPKDG
LRVNVAPLN

CYP196A3   Novosphingobium aromaticivorans
           NZ_AAAV01000177 
           complement(59115..60509) gene = Saro3719
           57% TO 196A1 
MASIAPDSRTDLHTERANPHWVRLGGDHKLDHVPGEDGWPVLGT
TLMQLADPLGFQRRMVETHGPVFRTRSFGRRGVNLIGADANELVLFDRDRLFSNEQGW
GPVLNLLFPRGLMLMDFEAHRVDRRALSIAFKPEPMRAYCSVLNTGIAQAVQGWGGQM
RFYDAIKALTLDTAASSFLGLPLGPEADRLNKAFVDMVQASGGVVRRPLPFTRMGKGV
AGRRLMVEYFGRLVRERRADPGQDMFSQFALATREDGSLLPEDVVVDHMIFLMMAAHD
TITSSATVLFWQLARNPDWQDRLRAEARAVTGGDGLPLAYEDLGRMELTEMAFKEALR
FMPPVPNMPRRALRDFEFGGYRIPAGTPVGISPAAVHADPAHWPEPDRFDPLRFTPEN
VSGRHKYAWVPFGGGAHMCLGLHFAYMQVKLLVSHILTRYEVAMQPGPAPSWQAWPIP
KPRDGLRVEMRRIC

CYP197A1   Bacillus halodurans 
           GenPept BAB04298 GenPept NP_241445.1
           34% to CYP174A1 Halobacterium sp. NRC-1
  1 MPTNTMPTGP KGNPVLGNTI EFGKDPLQFI TRCSQEYGEI VRLRFERERD TFLLNDPKHI
 61 QYVFMNKGGE FSKGYQQDPI MGLVFGNGLL TSEGSFWLRQ RRLSQPAFHP KRIADYADTM
121 VGYCERMLNT WMDNDTRDIN DEMMQLTMAI ATKTLFDLDL HKGDTQEASR SLDTVMTAFN
181 EQMTNVFRHV LHLIGLGKLV PPVSRELREA VESLDKMIYS IIEERRKHPG DRGDLLSMLI
241 STYDEDDGSY MTDRQLRDEI ITLFLAGHET TANTLSWAFY LLSQHPHVEE KLYQEVSQVL
301 GNRPATLEDM PKLSYAEHVI KETLRVQPTV WLISRRAEKD VTLGDYHISA GSEIMISQWG
361 MHRNPRYFND PLTFLPERWD NNDNKPSKYV YFPFGGGPRV CIGERFALME ATLIMATIVR
421 EFRMELVDEL PIKMEPSITL RPKHGVTMKL RKR

CYP197B1   Nostoc punctiforme
           NZ_AAAY02000014 GenPept ZP_00110793.1
           complement(44530..45885) gene = Npun5259
           44% TO 197A1
MVADVFELPAPSVNSIVGHLFELGQDPLGFLTRCRDYGDIVPLQ
LGLTPSCLIINPEYIEEVLKNRNDFIKSRGLRALKSLLGEGLLSAEGESWFWQRRLAQ
PVFHQKRINGYSQTMVEYTNRMVQTWHDGETHDIHEDMMRLTLQIVMKCIFSDDIDAG
EAKVVADALDVAMQWFESKRRQNFLVWEWFPRPENIRYRDAIAQMDEAIYKLIQERRN
GGEKTNDLLTMLMEAKDEQTLQQMDDKLLRDEVATLMLAGHETTANTLSWTWMLLAQN
PGVREKLESELNQVLQGKLPTLEDLGQLVYTQQIIKESMRLYPPVPLMGREAAVDTQI
GDYEIPQGMAIMISQWVMHRHPKYFENPEAFQPERWTQEFEKQLPKGVYIPFGDGPRI
CIGKGFAQMEAALLLATIAQRFQIDLVPGYPIVPQPSITLRPENGLKVQLKQIALDTS
K

CYP198A1   Xanthomonas campestris pv. Campestris str. ATCC 33913
           GenPept AAM42184          
           32% to 174A1
  1 MRRPAFPASV MNSSGAVWQH KRRTLMPAFR AALVRESAMQ ASAATRSLLH ELGDSCATQD
 61 MRTLMTGLCA QLGAGFLLGD SANAADLLRM LPMVDAISKQ TRRQSLAPTW WPSSGRRRLR
121 RLRADIDMAL DRILMQSTQR PPRAASVLAL LLAETARDDG DWCRDEAAAI LMSALEPMSA
181 ALTWTLLLLA QHPHIAQEVA QEASALDGAD VASGTSLLDR LPQSRACVKE SMRLYPPAWI
241 TARIAQRDAT LNGFHVPRGT QLLVSAWVVH RDGRHFPDPE IFLPARWLDD SATHSLTRYS
301 YFPFGGGPRS CIGCMLALTQ MTIVIATVLH ACSLHLAPDA RPSPFPALVL RPMDVRIALR
361 PRVIRSVVPS RAHASPVRLA SVTPND

CYP199A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC46313        
           NC_004463 complete genome 1159976..1161184
           39% to CYP145
  1 MSAPGSAASG VPHLDVDPFD MNFFADPYAA HELLREAGPV VYLDKWNVYG VARYAEVHAV
 61 LNDPATFCSS RGVGLSDFKK ETPWRPPSLI LEADPPAHTR TRAVLSKVLS PTVMKQVRDR
121 FAAAAEERVD ALIEKRSFDA IADLAEAYPL SIFPDALGLK SEGREHLIPY ASVVFNAFGP
181 PNQLRQEAIA RSTPHQAYVA EQCQRENLAP GGFGACIHAQ VDEGAITASE APLLVRSLLS
241 AGLDTTVNGI GAAVYCLARF PEQWQRLRGD LSLARSAFEE AVRFESPVQT FFRTTTREVE
301 LSGATIGEGE KVLMFLAAAN RDPRRWDKPD SYDVTRRSSG HVGFGSGIHM CVGQLVARLE
361 GEVMLTALAR RIAKIEITGE PKRRFNNTLR GLDGLPVTIT PA

CYP199A2   Rhodopseudomonas palustris
           NZ_AAAF01000001 
           3590168..3591556 gene = Rpal3146
           78% TO 199A1
MRPSGLGAAAADRRDFGGRDAPVMGMSAANACADIRTCHGISQV
AIEEDNMTTAPSLVPVTTPSQHGAGVPHLGIDPFALDYFADPYPEQETLREAGPVVYL
DKWNVYGVARYAEVYAVLNDPLTFCSSRGVGLSDFKKEKPWRPPSLILEADPPAHTRT
RAVLSKVLSPATMKRLRDGFAAAADAKIDELLARGGNIDAIADLAEAYPLSVFPDAMG
LKQEGRENLLPYAGLVFNAFGPPNELRQSAIERSAPHQAYVAEQCQRPNLAPGGFGAC
IHAFSDTGEITPEEAPLLVRSLLSAGLDTTVNGIAAAVYCLARFPDEFARLRADPSLA
RNAFEEAVRFESPVQTFFRTTTRDVELAGATIGEGEKVLMFLGSANRDPRRWDDPDRY
DITRKTSGHVGFGSGVHMCVGQLVARLEGEVVLAALARKVAAIEIAGPLKRRFNNTLR
GLESLPIQLTPA

CYP200A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC49097        
           NC_004463 complete genome 4251077..4252333
           39% to 107L2
  1 MAPRLDFTSE AFFRDPPAAI AALRASGPVV ATRFPLVGDV WITTTHDATA EVLKDGTTFT
 61 LRKEDGKVAG LRWWMPKLVT TIANNMLTMD EPDHTRLRSI VDEAFRRRAI VAMEPRIRAI
121 ADGLANDLFA DGSPADLVQC YARILPVSVI CELLGLPAAD RPRFIAWANK MSSLTNVVSF
181 FRLLFAFRKM RAYLERQLQI ARVRGGEGLI AELVQVELEG GQITPDEMVS MVFLLLAAGS
241 ETTTHLISGS VYELLRNPAL RDWLEEDWSR ISLAVEEFLR FVSPVQFSKP RYLRRDVELA
301 GVRLKKGDRV MVMLAAANMD PAVHDRPERL DLTRKPNRHM SFGTGIHFCL GHQLARIEAT
361 CALQALLARW PKLELAVDPA QIHWRKRPGM RAIARLPVVA GGNRRPSRGA AAEPLLAD

CYP201A1   Bradyrhizobium japonicum USDA 110
           GenPept BAC45822, NP_767197.1
           NC_004463 complete genome complement(596460..597827)
           35% to 173A1 40% to AAK24959 CYP192A1
  1 MNIASVRRPI VPPTPPRAPD DMSFLGRVAV IRQNMIATWG QRAYEEDVLE GRFFLHKSFI
 61 LNRPDAIRHV LLSNYENYTR TPAGIRMLRP VLGEGLLIAE GHAWTFQRRT LAPAFTPRAT
121 ANLVPHMTAV LDETIAKLDA RSGETVDLRE TMQRMTLEIA GRTMFSFGMD RHGPTLRNFV
181 VEYGERLGRP YFLDMLLPVS WPSPMDFARA RFRKRWTEFV AMLIAERRAA GKKDGAPPRD
241 LFDLMDEARD PETGKGFSDE QLIDEVATMI LAGHETTATA LFWALYLLAL DPDTQEEVAS
301 ETRGEHLDSM ADIDRQKFTR AVIEETMRLY PPAFLIARAA RAKDNAAGIE IGRGDIIMIA
361 PWLLHRHEKL WDQPNAFVPK RFMSTEAPDR FAYLPFGAGP RVCVGAPFAQ AESVLALARL
421 IGAFRVELVD TVPVIPHGVV TTQPDRSPMF RITRR

CYP201A2   Rhodopseudomonas palustris
           NZ_AAAF01000001 GenPept ZP_00010020.1
           complement(1953073..1954536) gene = Rpal1705
           65% TO 201A1
MGSAGAFSLPVSHTTFVEQQRGSGFEVSIAAIDDRPASRAPLIP
PTPPRAPENLSALGRLAAIRHNAIASWGDRAYQDDVVRGRFFAHSSYILNTPDAIRHV
LVDNTDNYRRTATGIRVLRPMLGEGLLLAEGRAWKHQRRTLAPAFTPRAVATLVPHMA
SATDEVVEGLRRKTGVPLDLRETMQHLALEIAGRTMFSFEMGTHGQALRGFVIDYGTR
LASPRFLDLLLPLGWPTPQDVSRALFRRRWTRFIGELIAARRAAGKAEGAPPRDLFEL
MLAARDPETGEAFSDAQLGDQVATMILAGHETTATALFWALYLLALDPDAQERLANEV
RRVGFGGTEIERLPFTRAVLDETLRLYPPAFLIVREAAGPDRVAGFAVRKHDVMLIAP
WLLHRHDKLWSDPNAFVPERFLPGVPSPDRFAYLPFGVGPRVCIGAHFALVEATLALA
KIVGTFRIELIDTEPVIPIGVVTTQPDRSPLFRLTPR

CYP201A3    Magnetospirillum magnetotacticum
            GenEMBL NZ_AAAP01000877 
            60% to 201A2 runs off the end
675 LILAGHETTAV 643
640 PLLWACTLLALSPETQERVAAESGQADKPFTRAVIDETVRLYPPAFVLARR 488
487 AAGVDTLGGETVQPGDSVTISPWLLHRHRRLWRDPDAFDPGRFLPGASPVPRFAYLPF 314
313 GAGPRVCIGAAFALTEATLALSRIVGRFRLARADARPVLP 194
    AAVVTTQPDHAPAFRLTLRT* 131

CYP202A1   Sinorhizobium meliloti
           GenPept CAC45831                 
           40% to 107P1 56% to 202A2 NP_108561
  1 MSIAPGITID GPARRVSLDV RNPRFFRNPL PAYAALHAQC PAFFWEEPQQ WFFAGYEQVN
 61 SLLRDRRFGR QILHVATREE LGMPEPKPHL KDFDALEAHS LLELEPPAHT RLRTLVNRAF
121 VSRQIEELRP EIEALSHAVI DGFEKDGETE LLKTYAETIP VTIIARMLGI PVEAAPRLLD
181 WSHRMVKMYV FNPSLETEFD ANNASAEFAD YLKGIIAEKR TNPADDLLTH MITSEKDGER
241 LSDAELISTT VLLLNAGHEA TVHQIGNAVR TILQSGLSPA ELFSDEKATE RTVEECLRFA
301 APLHIFQRYA LMDIELENGI ALRKGDKIGL MLGAANVDPR KFSSPDTFRP DRNEGANVSF
361 GAGLHFCIGA PLARLELQIS LPILFRRLPG MRLKNEPPVK DAFHFHGLER LDLVW

CYP202A2   Mesorhizobium loti
           GenPept NP_108561                
           42% to 107P2 56% to 202A1
  1 MTNSTLPYLA FDPATRRLRL DPHEPAFFLN PYEAYGFLHD VSNAFFWEEF GFWCFGGFDD
 61 VNRLLRDRRF GRQNPAGIPD SRGVGQDRSH LRAFDGIEAN SMLELEPPVH TRLRTLVNRA
121 FVSRQVERLR PRVEALANEL IDRFDPTGPV DLLPAFASPL PITIIAEMLG VPVEMGPQLL
181 DWSHQMVAMY IHGRTRETEE TANRAASEFA DFLRGYVAER RRNPGDDLLS LLISAQEDGE
241 RLSEDEMVSS AILLLNAGHE ATVHQTGNAV RSILAQGGDP SRFFTSAEAT AATVEECLRF
301 DAPLHMFMRY AYQEIEIAPG IVVRPGQTIG LLLGMANHDP RAFAEPQAFR PDRADQKNVS
361 FGAGIHFCIG APLARLELQV SLKTLFERHP RLHLAEQSRF RDTYHFHGLE TLAVGF

CYP202A3   Agrobacterium tumefaciens strain C58
           GenEMBL NC_003062 complement(1243027..1244274)
           63% TO 202A1
           locus_tag = AGR_C_2319
MTATFPFLKIDPATRRVSLNARDPAFYNDPNPVYAALHAQCPTF
YWEEQRQWFFTCYDHVSTLLRDRRFGRQILHVASREEIGLPEPLEHVKHFDLAEQHSL
LELEPPEHTRLRTLINRAFVSRHVDKMKPEIEELANRLIEAFEANGETELLSSYADII
PVTMIARMIGIPEEMGPQLLKWSHAYVGMYMFKRTPEDELLADKAAQEFSDYVRRVIA
ERRAEPKDDLLSHMIHTEHKGQYLTDDELVSTTIVLLNAGHEATVHQIGNSVRIILES
GLDPKTLFHDETATERTVEETLRICAPVHIFQRWVLEPVEIDGVQFKRGDKVSLILAA
ANLDPAKFSDPLAFQPDRNEGANVSFGAGIHFCIGAPLARLELNLALPLLFKRLPGLK
IAEPPKVKDVYHFHGLERLDLAW

CYP202B1    Rhodobacter sphaeroides
            GenEMBL NZ_AAAE01000131 
            30501..31682 gene = Rsph2231
            48% to 202A2
MQTLSQSPHDRRFLRNPYRFYREARAAGPFFHWEELGLVCTTSY
AAANAILRDRRFGREVPPGRASAVPDHLAPFAAVEAHSMLELEPPRHTRLRNLVLRAF
TSRRIGTMQPEVAALSESLVAAVPEGPFDLLPAFSQRLPITLIARLIGIPESLAPELL
RWSSAMVAMYQAGRTRKTEERAALAAADFSDFLRLHIEARRHAPADDLLTHLIAAEAD
GQQLSTDEIVSTCILILNAGHEAAVHAIGNAAAVLLRHRTPPEALAPPHLLGTVEELL
RFDPPLHLFRRMAYERVEIMGRTIEEGCEVALLLGAANRDPGPWERPDRFLWNRPEKT
HLAFGAGLHFCLGAPLARLELATALPILFGRLPNLQLVKPPSYGDSWHFRGLERLIVSA

CYP203A1   Rhodopseudomonas palustris
           NZ_AAAF01000001 
           2600909..2602096 gene = Rpal2284
           35% TO 113B1
MFSFDPYSPIVDADPFPLYKTLRDEYPVFWSEPAQMWILSRYLD
VAGAGSNWQVFSSAKGNLMTELPNRAGATLGTTDPPRHDRLRGLVQHAFMKRNLEALA
EPMREIARDAAEALRGRDQFDFISDFSSKFTVRVLFAALGLPMGDEQTVRDKAVLMVQ
SDPVTRAKGPEHLAAYAWMQDYASSVIAQRRAEPKNDLISHFSMAEIDGDRLDEREVL
LTTTTLIMAGIESLGGFMSMLALNLADFADARRAVVADPALLPDAVEESLRYNTSAQR
FKRCLQSDLTLHGVTMKAGDFVCLAYGSANRDERQFPNPDVYDVKRKPKGHLGFGGGV
HACLGSAIARMAIRIAFDEFHKVVPDYTRTEQQLNWMPSSTFRSPLRLDFAVEQAASR
SAA

CYP203A2    Novosphingobium aromaticivorans
            GenEMBL NZ_AAAV01000114
            complement(9289..10479) gene = Saro1156
            62% to 203A1
MATVIERPQFRFDPYSPAIDADPFPAYKVLRDEYPCFWSEEAGK
WVLSRYDDVLAALQDWRTYSSAKGNLVDEFPGRAGSTLGSSDPPRHDRLRALIQSAVT
KRALEHIIAPARASAQAHLAALADKPVFDLVGDYTSKLTVDLLFYLFALPDEGAQQVR
ENAVLMVQTDPVTRQKSPEHLAAFHWMADYAEKLVASRKANPGDDLLSSFITAEIDGE
KLLDKEVQLTVTTLIMAGIESLSGFMAMFGLNLADYPEARSALVADPSLIPDAIEESL
RFNTSAQRFKRTLTRDVELHGQVMKAGDAVILAYGSANRDERMFENPDVYDITRKPRR
HLGFGGGVHACLGSMIGRLATQIAYEELLKAVPDFRRADAPLDWVPSSNFRSPKSLML
EKKA

CYP204A1   Novosphingobium aromaticivorans
           NZ_AAAV01000167 GenPept ZP_00095854.1
           16299-17720 gene = Saro2888
           30% to CYP51A2 in Arabidopsis 27% to CYP51 M. tuberculosis
MARAATAAGNGLPLLDGGVPLLGHLAQFFRDPVSVLKRGYRSKG
RLFAMNFMGQRMNVMLGPEHNRFFFEETDKLLSIRESMPFFLKMFSPEFYSFAEMDEY
LRQRSIIMPRFKAASMKQYVPVMVEESLNLVERLGEEGEFDLIPTLGPVVMDIAAHSF
MGREFHEKLGHEFFELFRDFSGGMEFVLPLWLPTPKMVKSQRAKRKLHAILQSWIDKR
RAAPLDPPDFFQTMIETKYPDGRPVPDEIIRHLILLLVWAGHETTAGQVSWALADLLQ
NPDYQKVLRGEISSLLGGSDGRDLGWEQAVAMEKMDLALRETERLHPVAYMLSRKARA
DIERDGYVIRKGEFVLLAPSVSHRMEETFRNPDAYDPERFNPANPDAQIESNSLIGFG
GGVHRCAGVNFARMEMKVLVAILLQNFDMELMDEVRPIAGASTYWPAQPCRVRYRRRK
LDGSEAGADMAALARAAGCPAHT

CYP205A1   Chloroflexus aurantiacus
           NZ_AAAH01000322 GenPept ZP_00019057.1
           1835..3214 gene="Chlo2055"
           41% to 197A1 and 197B1
MIPAIPVLIGDTAMIRFPSPVAIRNLQQLRREPLTLLEELAARG
DVVPFRVGPQMMVLVNHPDLIREVLVTQHRSFVKGRVLERAKRLLGEGLLTSEGELHL
RQRRLMQPAFHRQRIAAYGDAMVAVAEARSARWQDGLVLDVSREFMAITLQIVGITLF
SADTEADADEVFAAMHDLVAMFDLAVLPFADWLFALPLPPVRRFQAVKARLDAIIYRL
IAQRRANPVDRGDLLSMLLTAVDHEGDGYRMTDTQLRDELLTIFLAGHETTANALTWA
LYLLAQYPSLAAHLAAELDTVLGGRKPTVADLPKLTYTSWFFAEALRLYPPAWLIGRR
AIAPVTLGDVRIAPDTIVLLSPWLMHHDPRFFHEPYHCDPLRHTPEAQAQRPKFAFFP
FGGGPRTCIGEPFAWMEGILVLATLAQRWQFLPVADHPVVLQTGITLRPRYGMQLQLR
ERRTVLGAA

CYP206A1   Agrobacterium tumefaciens (strain C58, Cereon)
           GenPept H97549
           NC_003062 1555403..1556797
           34% to CYP173A1
  1 MTEIGFRTPS TDTTGAQPVS KLATARLALS LIRNPLKALP PEIFSEPAVF TRLGGVMRVH
 61 LADPVLIHEA LVKNAALLGK GEDVRRALGP ALGQGLLTAD GDHWKWQRQS VAAAFRHEKL
121 LELLPVMIET ARRTQKRWRS SSTADIDIGH EMMRTTFDII VETMMSGGYG IDIARVEQSI
181 TDYLKPTGWT FALAMLGAPE WLPHPGRRKS RAAVDYLRAS LATVITGRRK NPTDRPDLVS
241 MLLEAKDPET GRMMSDEEII DNLLTFITAG HETTALGLAW TFHLLSQNPE TERKAVEEIE
301 AVTGGEPVAA EHIANLAYVR QVFSEAMRLY PPAPVITRTA LQDFRLGEHD IPAGTVLYVP
361 IYAVHRHTAL WDEPERFDPS RFEPEKVKAR HRYAYMPFGA GPRVCIGNAF AMMEAVAILA
421 VILQKNHLEN RTMASAEPLM RVTLRPQERL MMKITQRQNK SPAV

CYP207A1   Kitasatospora griseola
           GenPept BAB39208  
           GenEMBL AB048795 6250..7698
           30% to 183A1
  1 MKGNLPAMST ATSSSVTGSV TTPRTATTPG RRPGLAPGGV PVLGHLPMIL RSRFEFIETV
 61 RNAGPVTRVK LGPKTAYFVN DYELLAQILV SDADKFVRGI HFKKMRNMVG NGVVTTSGDL
121 HRRQRRIMLP SFSQRRLAMH LPVMRKIMSE FVASVPERRP YDLMGPVMGV GCDIVTSTML
181 GEKTPPEVLR LVREAVPVFV ENAAIQAVDV TGIYKHLPTK SNRDFERLLN AFNEYMYSVI
241 DDKFRNGAGE EAGLLDMLIN ATDPETGEKF DRTEVRDQAA TILLASTETT ANTISWACYE
301 LARHPRIFAE CRAEIDALVK DRDWLDIEIG RHDLPALKRV LFEALRMYPS SYLLSRQASV
361 DTTLGGYAIP KDAAILYSHY GQQRDERNFP HGDEFDPDRW LDKDGAEVTA SAFMPFGFGA
421 YRCLGESVAV LEATYCLAMM VHQWDFALSD YSEPKMNATI TLSPKDLEFL FTKRTESGAH
481 DE

CYP208A1   Streptomyces globisporus
           GenPept AAL06697  
           38% to 184A1 
  1 MRIDPPGPPL RALPGLLRKL AVDRLGMMRD AAGLGDAVRV SMGPKKLYIF NRPDYAKHVL
 61 ADNSDNYHKG IGLVQSRRVL GDGLLTSDGE TWREQRRIVQ PAFKPGRINQ QAAAVAEEAA
121 KLVALLRGHE GGGPVDVLQE VTGLTLGVLG RTLLDSNLTA HESLAHSFEE VQDQAMLEMV
181 SQGTVPAWLP LPPQARFRRA RRELYRVADL LVADRRSRMA DGGPGDDALS RIIVAADRRR
241 DDPARARNRL REELVTLLLA GHETTASTLG WTLHLLERHP EVRDRVRAEA RAALGDGVPG
301 PEDLHRLTYT TMVVQEAMRL FPPVWILPRV AQQRDVVGGY TVSAGSDVLV CPYIMHRHPG
361 LWEDPERFDP ERFEPRQTAD RPRYAYIPFG AGPRFCVGSN LGMMEAVFVT ALVTRDLDLR
421 TVAGHRAVAE PMLSLRMRGG LPMTVSTAR

CYP208A2    Streptomyces carzinostaticus subsp. neocarzinostaticus
            GenEMBL AY117439 
            complement(50199..51551) 
            70% to 208A1
MNGRRPVSPPLRALPGLLRKLAVDRLGMMRDAAALDDAVLVSMG
PKKLFVFNRPDYAKHVLADNAANYRKGIGLIESRKMLGDGLLTSEGELWREQRRTVQP
AFRPARVAAQADAVAEETMNLRDLLMRRGADGPVDVLQEVTGFTLGVLGRTVLNTDLG
GYGGIAHAFEAVQDQAMFDMVTQNMVPTWAPLATQRRFRRARRELIRTVDELVADRSA
RMTDGEEADDAFSLMIAAARRQTDPRTGQGRLRDELVTLLLAGHETTASTLAWTLLLL
ARHPHMRDLVREEARGVLADGRAPDAGDLRKLTYTTQVVQEAMRLYPPVWILPRVARQ
SDEVGPYSVSAGADVLICPYTLHRHPDLWERPEQFDPGRFDPARVADRPRYAYIPFGA
GPRFCVGSNLGMMEAVFVTALLTRDLVLEVVPGDERTPEPMMSLRMRGGLPMTVRPVR

CYP208A3   Actinomadura madurae 
           GenEMBL AY271660 10415..>11426
           maduropeptin biosynthesis gene cluster
           partial sequence RUNS OFF END
           69% TO 208A1
           gene = madE7
MSIDELDARGGTPRAAGRVPPGPPRRATPNLLRMLATDRLGMMQ
AALRHGDAVRVGLGPKALYLFNRPEHAKHVLADNSGNYHKGIGLVQARRALGDGLLTS
EGDLWREQRRVVQPAFQHKRIAGLADAVVEEAGALVARLRARAGGPPVDVVGEMTALT
LGVLGRTLLDADLTAHTSLGRAFETVQDQAMFEMVSQGMVPMWLPLPGQLRFRRARRE
LDRIVRALVAERLREGGGAEDALSRLIESARREPDGRVGRRRLRDELVTLLLAGHETT
ASTLGWTFHLLDRHPLVRARVRAEARAVFGDGTPTLDDLSALSYTTMVVQEVMRMYPPVWI

CYP209A1   Myxococcus xanthus
           GenPept CAB40542 
           38% to 110D2
  1 MGTSEPVEPD HALSKPPPVA PVGAQALPRG PAMPGIAQLM MLFLRPTEFL DRCAARYGDT
 61 FTLKIPGTPP FIQTSDPALI EVIFKGDPDL FLGGKANNGL KPVVGENSLL VLDGKRHRRD
121 RKLIMPTFLG ERMHAYGSVI RDIVNAALDR WPVGKPFAVH EETQQIMLEV ILRVIFGLED
181 ARTIAQFRHH VHQVLKLALF LFPNGEGKPA AEGFARAVGK AFPSLDVFAS LKAIDDIIYQ
241 EIQDRRSQDI SGRQDVLSLM MQSHYDDGSV MTPQELRDEL MTLLMAGHET SATIAAWCVY
301 HLCRHPDAMG KLREEIAAHT VDGVLPLAKI NELKFLDAVV KETMRITPVF SLVARVLKEP
361 QTIGGTTYPA NVVLSPNIYG THHRADLWGD PKVFRPERFL EERVNPFHYF PFGGGIRKCI
421 GTSFAYYEMK IFVSETVRRM RFDTRPGYHA KVVRRSNTLA PSQGVPIIVE SRLPS

CYP210A1   Polyangium cellulosum = Sorangium cellulosum
           GenPept CAD43453  
           spiL biosynthesis of spirangiene
           40% to 110E2
  1 MISISKSKQK LLPPGPRSPM ALQTLQWLKN PVPFLEACGA RYGEMFTLKL PTQWPVVVVQ
 61 HPEAVKEVFA LDSNAGHAGE ANNILKPFLG KYSLLVLDGE EHMRQRKMMM PAFHGERMEA
121 YGHAMIDAAH ASIDAWPVGS PFGVHAPMQA ITLQVILRTV VGMTDGPLLA ELEALYPQVI
181 DAASAPAMHF ELFRKDLGPW SPWGKFKRRS ARGKEIMIHE IRRAREKGTA GRTDVLAMII
241 DAKDENGELL TEDEIHGELM TLLVAGHETT ATALCWALRW LLRDAALTRR VAEEAAEVAD
301 DPVKIAKSEL LDRVVKEALR LQPIGPVVAR VLKQPLTIQG RELPADVMVA PCVQLLHHRP
361 SLYPEPTRFD PDRYATFTPK PWEFIPFGGG LRKCIGAAFS MYEMKMVLAT AFSRLSMELA
421 TDDIKIIRRG VTLAPSGGLP LVIRKKSPRA TKPIAA

CYP211A1    Streptomyces globisporus
            GenEMBL AY048670 
            47223..48479 ORF29
            39% to 107L1
MAGLVMSPVEALDALGTVQGRQDPYPFYEAIRAHGQAVPTKPGR
FVVVGHDACDRALREPALRVQDARSYDVVFPSWRSHSSVRGFTSSMLYSNPPDHGRLR
QVVSFAFTPPKVRRMHGVIEDMTDRLLDRMARLGSGGSPVDLIAEFAARLPVAVISEM
IGFPAKDQVWFRDMASRVAVATDGFTDPGALTGADAAMDEMSAYFDDLLDRRRRTPAD
DLVTLLAEAHDGSPGRLDHDELMGTMMVLLTAGFETTSFLIGHGAMIALEQRAHAARL
RAEPDFADGYVEEILRFEPPVHVTSRWAAEDLDLLGLSVPAGSKLVLILAAANRDPGR
YPEPGRFDPDRYAPRPGGPEATRPLSFGAGGHFCLGAPLARLEARIALPRLLRRFPDL
AVSEPPVYRDRWVVRGLETFPVTLGS

CYP212A1    Chromobacterium violaceum ATCC 12472
            GenEMBL AE016919 complement(139513..140919)
            NC_005085 complement(2867614..2869020) 
            locus_tag = CV2656
            57% to 2A12A2 33% to 205A1
MKTPPQSSCPFHAVGRPPTPPRSSAGRWPPGPESGLTGWGLLKL
MSRDLMGTLAGWQREFGDLVHVRTWPEHQVIVSDPQLARELLVNQADALQRWERALTV
YRRVHGHSVLIAEGQVWREKRQALQPDFTRKSVQAFSPSIVEAARRAFEQWPARHAAW
PIESELTSVTMEVILRMMFSSGVGSEAQQAEEAVHTLMVASTEELWRPASLPDWVPWQ
RKRRRARLLMNGLIERHLQARLAMPQDAWPEDLLSRLLRLHLQQPQSWPLQAVRDECK
TAFLAGHETVATSLTWWAWCMASHPEIQERAREEALAALSGGGQADPAALQYVSQTLL
ETMRLYPAVPLLMSRRALKPVTLGDWTFPAKTVFMVPMQLMQHDERWFPEPRSYRPER
FGPDAARPQQGAYLPFGGGPRVCLGQHLAMAEMALVAAQLLLRYRLSAPEGAEPPRPV
FHVSQRPSQPLTLGIARI

CYP212A2    Ralstonia metallidurans
            GenEMBL NZ_AAAI01000313 
            14554..16035 gene = Reut2995
            57% to 2A12A1 32% to 197B1
MTVDVVSIQDSPRGSVWNLHMTTESQAQCPFQTAKSPPPAGSPL
PHPYGTWPPGPAAGLTGWHLLRRMSRDLLGTLGEWQQTYGDVVHLRMWPEHAVVVTDP
QLVRELLVTHHDSLIRWERGTRVFSRVHGHSVLTAEGDAWSRKRQALQPGFMPKAVHG
FVPGIVEIVDKGLATWPTRVADWPVESALTSLTMDVIVRMMFSDEIGEDARVAECAVR
AISEAANADFYWPASLPDWVPWKRARRRALHTLRDLIERHLQARLRMRTDTWPDDLLS
RLLCLHRDDATAWPLQAVRDECMTTFLAGHETTAATLTWWAWCMASNPSAQDAARAEV
THVLRGQAPTADSRQALRQVVQTITESMRLYPVAPVLISRRAVRPITLGPWRLPARTL
FMLPLQLMHHDPRLFPEPERFQPDRFSTGSPQAPRGAYMPFGTGPRVCLGQHLATAEM
TVIAAMLLQRYKLSVPEGAAHPRPLLNVTLRPDQPLWLAVTPI

CYP213A1    Synechococcus sp. WH 8102
            GenEMBL AABA02000001 or GenEMBL BX569692 335184..336428
            63% to 213A2 31% to 120A1
1370816 MTAAPLPSTGAVTGLGETLAFFRDPSFSQRRFSELGDVFETKLLAQSIV
        FIRGERAIGDLLKQEDCLQGWWPDS
1381038 VRQLLGSKSLANRSGADHKARRRVVGQLFSSAALS
        RYTPAIEALVNDLANELQQAEGPIPLAARMRRFAFSVIA
        TTVLGLEAENRDALFADFEIWTRALFSIPLALP 1381358
1381359 GTPFARALAARQRLLARLKTVLQTNNNRQQGGLDLLSGGLDEAGLPLDDDDLVEQ 1381523
1381524 LLLLLFAGYETTASSLSCLFRALLLNPEVEQWLMQDLNNHERPSRLDATVL 1381676
1381677 EVMRMTPPVGGFFRQNTQSIELADVAIPQGRVIQVVLSSSSTTNQIDLETFRPQRHL 1381847
1381848 DGSFQQTLLPFGGGERVCLGKALAELEIRLMAMGLLQRVQLHL 1381976
        EPDQDLNLQLIPSPTPRDGLLVRATAR* 1382160

CYP213A2    Prochlorococcus marinus str. MIT 9313
            GenEMBL AAAZ02000001 
            63% to 213A1 35% to 120A1
1661568 MASSDDAKLRPLPNTAALSGVLEAFAFFRDPAFAQKRFERHGNVFETSLLGQPMVFIQGGQAIRDLLA 1661771
1661772 QPNAVEGWWPESVRQLLGSHSLANRNGASHRARRRVIGQLFSASALQRYSAGIISMVQ 1661945
1661946 DLADELQAAKTALPLAERMRRFAFSVIATTVLGLEGTDRDELFVDFEIWT 1662095
1662096 RALFSIPIALPGSSFAKALKARERLLRRLQKVLLKASNGNGGLDLLAGGLDE 1662251
1662252 AGIPLTDEDMVEQLLLLLFAGYETTASSLSCLMRELLLNPQVETWLREEINGVDWPPAPE 1662431
1662432 QATTAYDQVNAPKLDAVVSEVMRLTPAVGGFFRRTKCALVIDGVEVPKNRVVQVALA 1662602
1662603 ASNRHGAGDLEAFRPQRHLEDGCSATLLPFGGGERVCLGKPLAELEIRLMVVGLFHQLR 1662779
1662780 LHLIPDQDLTLQMLPSPTPRDGLLTKVL* 1662866

CYP214A1    Trichodesmium erythraeum IMS101
            GenEMBL NZ_AABK02000024 
            74165..75511 gene = Tery2345
            36% to 120A1
MNMNFKSSNPASSLALPPGDLGLPFIGQNKKIFKNPQNFIEEVY
QKYGPVYKTNFLGKNFIYFQGYEAIKFILTNENKYFTYSQILRNYQRIFGENDITVLA
GKEHRERQKILAKTIKSKNLNNYIDIIHDLSQSYFLKWIKSDYVDLYSEINNYTLDMI
LKLLLGIDYASKSEISNYLKDMSSGLNTIPVVFPWTKFGSALESKNKLFNQFEQIIVR
RKKENNFGSDILGILLTVQEQMNYELTPREIVGQMVNLLSLGKKELSSALSSFFILTS
EHLDVLKLLQIEQEKMDVSEPLSLDKYKKMVYLEQVIKEVLRLVPPVSGGLRKIIEDC
SFQGFRIPKGWHAYYYISSVLKDPEIYKQPEIFNPERFNPTNAEDKKKPLCYIPFGGG
ARECIGKEFAYLVIKIFISALLDNCSWKFKENQDLTINTFPVARPAHKIEVCFTPK

CYP215A1    Thermobifida fusca
             GenEMBL AAAQ01000026 
             complement(53223-54434)
             35% to 127A3
MPAPIRIQQCPVSHTDFSTDTEIYG
HYAMLDAEREASRFRFNDTTDRGFLMIQRYDDVVEGFQHHETWTTKVRSAINPDSRSGTA
LLPQDLNGEAHAKLRRVLNPFFSPAAVRRMEPMAVARCIELIEELQPKGSCDFVAEFAIR
YPTDLFLALLGLPVSDGEFFLPWSETVFAGFFGEDPAKVAEARKNIIDYFTETIRERRAN
PRDPKEDMVTRLLEARIDGTPIPEEDILTICLTLMLAGLDTTRSALGYIYAHLARNDADR
QAIIDNPDLVPRAVEEFLRMYPLVFQVGREVQEPTEFHGLDLQPGDVVWLGIAQANRDPR
KFPEPDRFNPDRKGVNQHIAFGAGPHRCLGMHLARLELAIVLREWHQRIPHYRIREGVTL
TERGGQLTLPTLPLEWEA*

CYP216A1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000039a 
            98411..99769 gene = Tfus2242
            37% to NZ_AAAQ01000042   Thermobifida fusca
            39% to 157B1
MTRSPSPPIRLYQAADPTALWPALLAEYGEIAPVELEPGINGWL
LLSWRLNREVMRDAETYARDPDRWADMANGRIGPRSPLRVLYGKYQSALYSDGADHKR
YRAALTAALDSLSLRQVTGHITAAADQLIDAFCLHGKADLVTQYTRQLTVTVLARLFG
LGPAETMRICLEMQAMWDEGPNAFPALMRIAEMLTELARKRRRTPGKDLASVLVAQGL
SDVEVRDNLLLIIAAADDPVTHLTGNTIRMLLTTPESRAALTTSPGLISEAVNTALWT
TPPLQTLVGRYPVRDVELAGVPIRAGECLVLGFAAASLDLAQHSDADTMSTNRAHLTW
GVGPHSCPLRGQDMALAIAETAVERLLRRLPDVALAVPPEQLRWRPSLAVRGLESLPV
RFTPTPVSNPGGTEWDSPADPTPSTSIRPKESTSPRSDANSSTKARWYAWLFPGTWKS
GL

CYP217A1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000029b 
            complement(46399..47577) gene = Tfus0917
            39% to 145A1
MTTLAPSTDLDFYSEEVILNPYDTYRRLRDTAPAVWLERYQVWA
VTRYDDVYAALHDHRTFASGYGVALNDPLNEKMKGSALVSDPPYHDHVRGVMGGPLTP
RALRKHHDYFQERADALIDHLLELGRFDGVRDFAQIFPLSVVPDLLGWPAEGREHFLD
WASAGFQALGPMNERALRDLPTLKGMWEYMAEIVRPGRLAPGSWGAALVEAAEKGEVD
KQLLPALIGDYLVPSLDTTVSALSTMLWQLGENPDQWRMVREDPSLIPNVLNESIRYE
APIRALSRYVTEDTEIGGIPLARGSRALMVYASANRDERHRKDPDTFDVTRSNANTHV
GFGHGIHGCVGQGLARLEGHSLLNALVRKVARIEVGQPTWRVHNTIRAMTTLPVEFSA

CYP218A1    Thermobifida fusca
            GenEMBL NZ_AAAQ01000042b 
            complement(348226..349737) gene = Tfus3015
            35% to 156B1
MILNCEHDPVFHVPVVSTPGRWSVTHPLYPVGNSDTPHDRNAGS
SEGCPVSLDDREALHRLAVPVYGELDADLPDVLERLRKQFGRIAPVEVAPGVAAWILL
GYDVNRRVLQDSAEFARDPRRWREAREGRATPEKVPGPFWYFRNALASDDPDHSRYRP
VIVDALSGITADGTRLAVRRIATELLAPVALTGKADLVADFAFRVPLLVLNRYFGLSA
EEGLELVELMRQVWDGGEEAEKARLGLFAYAQSVTARRRENPGSDIVSRMVRHPNALD
DEEIAHQLILLISAAHDPLMNLIANTAHTLLTDEEVRYDLAGAHLRVEEVVDTVLWRS
PPITLLPGRYPVRDTLLEGAYVQEGDCLIIGYGPAHADPAVAPYIDPLSPSGIRGHLA
WGTGPHACPAQRISRQIAVDAVSALLDLLPDVRLAVPPESLERRRSLFAHGLKALPVT
FTPVDITPPTEAPWQQSQNPSSSSQENPASKPSSSVKRGRLPEWWSKVWKFGR

CYP219A1    Novosphingobium aromaticivorans
            GenEMBL NZ_AAAV01000054 
            complement(4309..5553) gene = Saro0307
            41% to 107AA1
MEAEAAIPPLDTSDPALIPDPWPTFTTLRERDPFHWSKYGYWVV
SRHEHVRDVLMNRKDFGTGDFAANLRLFYGPDFDVLANPAYRWLSEVFIMQDPPQHTR
IRNLVVGSLTAKRVRAMEPRIREIAQALTDGFKARGSADLITEFAYKFPVMVICDLMG
IDYEASEMADLIAAIPEAFTVFEARILSPEELALANRRILELEAFFQAQFENRLAHPR
GDLLTSLARTGQEPGGLSVHEAITVTIGLFGAGFETTANIIGNGLHALHANPEQWARL
VADPSGMASGACEEALRHQSSLIATYRTALADTSVCGHPVSAGQRVLTLIGAANRDPR
KFADPDRFDIARNDADHLTFGGGIHFCVGAELARIEARVAFEHLARELPQMQVDTGGA
CWRENFLFRGLTGLEARWPAQA

CYP220A1    Burkholderia fungorum
            GenEMBL NZ_AAAJ02000117
            18981..20198 gene = Bcep1617
            35% to 107B1
MTFIYDPNDPDVRRDPHAVFRKLRETEPVHWSPKLSGWVVTSYE
LASEVLTTNGTYSAERFTAVQQHLSEEKRVTAAEVMRWFQHWMVFRDPPDHTRLRRHM
ANTLNIPVFDARRETVISVVNELLDRIPVGDAFDFFQAFSLWMPGIVVADLLGVERDR
LLEVKQWSDDMMTFIGSARGVPDKYERARRGANGMGTYFLDLIAKRRAEPREDALSRL
IASEVEGQRLSDDELVGCMMMVLNGGHETTANLLNNSMLALAAHPQTVQHLRQHPDEM
AAAVEEFLRYDSPVLSIGRIVTEDTELGDQEIAAGDRVFAMLVGANRDPEVFSDPDEL
RTSRNPNPHMAFGKGPHFCLGTPLARLEGQIALTAILERFSSIELCEPVESIPWLNSL
VTHGPTRLPLRLK

CYP221A1    Pseudomonas fluorescens PfO-1
            GenEMBL NZ_AAAT02000002
            complement(179015..181831) gene = Pflu5298
            36% to 107B1
            N-term is 38% to acyl CoA oxidase of Streptomyces coelicolor
MSDPLLKLLQKPLFDPEKRHRVSLREYMDLNIDRMRAIIGNGLM
TNAMWLSQPRQSEFRLMLERAALIGAVDYSLLACIVDHFIAGDAFFAHGSQHQIAQYH
QEICQLKAVYAFGCTEIASGSDVANLQTTINYDPHKHCLILNSPTPQSCKFWIGNALH
AAVVVMVLGRLIVKGVDEGLHWFRVRIREQENGPLLPGVRITTCDPKGGIHANQVAGI
RFCNMKLPLDALMQRYARFSAQGVFSSEIPPKERLKSAMQTFIQERLFLIAGARGAAS
MCVYLAYRFACHRLVKGNEGSQSLLTKALFRQRLYAEQLKVLALKLLEQAVLSRFEAC
WHQPARRKELHILAAVVKSVGTWLGLEVMSACRELCGSQGFHHHNRIVTLVMDHGIST
TFAGDNNILCCQVARDAINRPRFANENIAQRIESLIVDQCRRAGDFSHRQAVALTYAR
ALDLIINEGKHHPLVTSEIFEDIVHVFSPKLYEWELVASTKLEQNATEAQLILLNELL
KPPSELVRAPIDKKNYVKHF  TKPLYDNKPDFSNRNTIRNPYRAYTWLRKHQPVYWCEH
LQAWFLTRYCDVIAAQADSRRFSSNRMQQLIDARVPENKRTHLNEFIKLASRWMYSQD
GDTHKASRHLLGNAFTPRSIEALRAIIQDITDRELSRLHGQTDLKTALFDRVPALILA
RLYGMKDDEALRLRRWTRDIVMFLGGSQDADQGPDQALEGIKEMYACFAELIEQRRRQ
PGDDLVSRVLESGQNSAASLDEVLAQIVFILVAGYTTSADQMCLGLLHLLKHPQQLEA
LLADPTLIGSFIEEMLRFDPAGSLSHRILMEDVTIDNITMKKGNLVYLIRASANRDPE
KFHAPNTFDIRRARNEHLTFGKGEHFCMGTSLFRLEAEIVFTSLLKRFPDLQLIARRP
AKWRNSNLQFRGLKTLPVDLGTGV

CYP222A1   Thermobifida fusca
           GenEMBL NZ_AAAQ01000022.1 
           52729..54468 gene = Tfus0480
           33% to CYP101
MSLRGLPGTAPRQRAGSPGPASFLKRRRDAAPRPTISLDGDGPL
RAGLGSIPGRRLQFGAHLFVEHVGVPVFFARRKHVGRGHVAHTVPLALLSVDSDAHVA
LLRDQRSLFSLAILTLMLLSITIITRTAIKITHHTRSRHRPYPHSSQRTSAHEPGQER
AHSMSNPTRCPVIHFDHHSPEHAKDPVGAYRALRQTHKRGWTEAHGGYWVLSDYQSVF
DAARDDDLFSSTREAAGTDGLAIVIPPTPMYHHIPIEVDPPEFRKYRKIVNQVTAPAA
VERMKEMVERYTVAFVDSVIEKGECDFTTIIGVPAIVTIDWLGLPVKDWKRYADAHRA
TLAEPQDSEAFRHAVEVELPALSQQMWDTIRARRQEPKDDVISFLVSQKVDDRPITDE
EVFAMVDLLVSGGTGTTASLVSQALVWLAKNPDVRQELIDDLSLLDRAVEEFLRVFSP
TQALARTVTRDVEFHGCSMKKGDRVLLSWASANRDEEQFENPDTIDIHRWPNRHVAFG
IGVHRCAGSHLGRFMAKRLLQEILTRMPDYTIDFDALVPFHDQGTNVGFRSIPAKFTP
GKRVLPLSEAVIG

CYP223A1   Novosphingobium aromaticivorans
           NZ_AAAV01000162.1
           complement(33798..34988) gene = Saro2671
           31% to 194A1
MHRAMTTTVQDFDPEVPEDFDSPHAEYARLRRECPVAHTNGLGG
FWALTRYEDVKRAASDSTTFITSVQNVVPKVAFTGRRPPLHLDPPEHTPYRKALNPLL
SLERSEAFAGKARELTRKLLAPMVENGGGDICVELSSYLPVHVFGEWMRMPEEWLDTL
HDAGRAFILAVHSNTPERMKETSLRLYDMARGLIAVRRENPQDPALDPTSALLAARHE
GEPLPEELLVGTVRQVLVVGMVAPMVMIGNICVHLSRDKALQQQLRADPSLVPAAIEE
FLRLYTPYRGFARTAVCDVDMGGRTIPKDEAIALVYASANRDEDVFPDGDKFILNRPN
IAQHLAFGRGPHNCPGVHLGRMQLRVALEEILAATREFELSGPVSVSRWPEVGALSVP
LRFV

CYP224A1   Novosphingobium aromaticivorans
           NZ_AAAV01000154 
           complement(32211..33443) gene = Saro2336
           36% to 127A2
MTLLFQPSPPDHVPGERMVDFDMFHVPEGQDDPVEIWHDLVRRG
VPRIFYTPRNGGHWVFLDYADIVEAYRDHTVFSTYQTPVPPIEPFPVVQPQGVDPPAH
NVFRRLLAPMFTPTAVRGMIGELERRASELIDRFAARGECDFITEFAERFPTSTFLHL
FGLPEEQLDAFLALANVFFRSTDAETRARNIGEIYAVLDTLFREKERNPGNDIASAIV
AARDEEGRQHPWEDILNCGFLLFVAGLDTVTNTMAYIWRYLATTPAARRHFRERLDDP
DAFLRAIEELMRINAVSNLFRRVTHDCEYKGVQLRRNDRVVLPNTVANRDPRVFSDPQ
AIDLDREVNVHLTFGVGPHRCIGSVLAKREVMVSLQQWLRRIPEFELAPEQPAGSAFG
GSVMGFTALRLRWVRVEA

CYP225A1   Novosphingobium aromaticivorans
           NZ_AAAV01000151 
           17550..18872 gene = Saro2207
           34% to CYP124
MPSPPRLAGTSTASGLEDQMQFPFSRSTNPNVDLSSLDAFNEGA
PFATFDRMRREDPMAWSEMVNGDRGFWSVTRHADLLELNRQADLLSSAKGIRMEDQTE
EEYEARKTFQETDAPHHRGFRALVSKAFSKGTVAGFEDQIRKIVTDLLDVALAEGEFD
AVDRIARRLPMQMLAQIMGVPQEDGPWLVEKGDALISNSDPDYTDFVVDQVDTEAYRM
LPFRSPAAVELFDYANGLLDRMDAGEQIGVLNLVREPTSTGTRMSRDEFRNFFCLLVA
AGNDTTRYSISATIHALANNPHLLQALKDGDFTSWEAAADEMIRYASPTTHFRRTATR
DFTFHDRHVKAGDKVLLWFISGNRDETAILDPYTINLRRERNPFLSFGQGGPHICLGM
WLAKLEVAIVMQELAKRLSSIEQVAEHSYLRSNFIHGIKHLPVRIVAR

CYP226A1   Burkholderia fungorum
           NZ_AAAJ02000018
           25472..26761 gene = Bcep5906
           61% to 226A2 30% to 109B1
METGMTSPAKSNALESAFESTASNYRGSDVDLNAIYRDMRRNSP
VIAQDFMASLGVPNIAKLDPNRPTFTLFKYKDVMSVLRDAANFTSGFIAEGLGSFFDG
LILTGLDGEAHRRARALLQPVFLPEVVNRWRESKMEPIVRNEFIGPMVPQRRADLMHF
GLHFPIRLIYSLIGFADDRPEQVEQYAAWALAILAGPQVDAQKAAIARKAAMEAAEAL
YAAIRSEVAVVRAKGAEGEDLISRLIRAEYEGRRLDDHDIATFVRSLLPAAGETTTRT
FGSLMTLLLERPALLERVKADRSLVSKAIDEAVRFEPVATFKVRQAAVDTGIGGVSIP
KGAMVQCIVSSANRDEEVFENSETFDIDRKPKPSFGFGFGPHMCIGQFIAKVELQVAV
NAILDLLPNLRLDPDRSPPKIVGAQLRGPDAVHVVWD

CYP226A2   Burkholderia fungorum
           NZ_AAAJ02000018
           complement(62819..64102) gene = Bcep5938
           61% to 226A1 32% to 107N1
MSTTLENPMLDLEAAYHAVSDTYRGPDIDLQALCREMRHKNPVM
KGDFVATHLGIPTNAGASAAKCEVTLFRYQDVLAVMRDATTFTNGFIAEGLGGFFDGL
IILAMDGDAHRRARGLLQPVFMPETVNRWRPELDRVIREDFLAPLVPNRHADLMDFGL
YFPIREMYALMGFPTDDTAKFNQYATWALAMVAGNQIDPGKIRIFGPIAAAAVKHLYD
AVMEVVLQRRAAGADGNDLISRLMRAEYEGHKLDDHEVTTFVRSLLPAAGETTTRTFS
SVITLLLERPALVERVRNDRSLIPRLIDEAVRYEPVATFKVRQAARDIEIGGVKVRSG
GLVQCMVMSANRDEDVFENADTFDIDRKPKPSFGFGFGAHMCIGQFVAKIELQCAVNA
ILDLFPNVRLDPARPAPKIAGAQLRGAKSVPVIWD

CYP226A3   Pseudomonas diterpeniphila
           GenEMBL AF274704 7700..8974
           P450 monooxygenase (tdtD) gene
           72% TO 226A1 32% to 159A1
           note="abietic acid metabolism"
MSGPAHSNLEQVFANVASNYRGADVDLHAVYREMREKSPVLPEN
FMARLGVPSIAGLDPNRPTFTLFKYDDVMAVMRDATNFTSGFIAEGLGSFFDGLILTA
MDGEAHKNIRSLLQPVFMPETVNRWKETKIDRVIREEYLRPMVASKRADIMEFALYFP
IRVIYSLIGFPEDRPEEIEQYAAWALAILAGPQVDPEKAAAARGAAMEAAQALYDVVK
VVVAQRRAEGATGDDLICRLIRAEYEGRSLDDHEITTFVRSLLPAASETTTRTFGTLM
TLLLERPELLARIREDRSLVGKAIDEAVRYEPVATFKVRQAAKDVEIRGVAIPKGAMV
SCIVTSANRDEDAFENADTFDIDRRAKPSFGFGFGPHMCIGQFVAKTEINCALNAILD
LMPNIRLDPDKPAPEIIGAQLRGPHHVHVIWD

CYP227A1   Nostoc punctiforme
           GenEMBL NZ_AAAY02000109 21775..23139
           very poor similarity to P450s
           gene = Npun0867
MTVNIMTLKDKVLKGQDRQLWLAPILAKVGYDTAIGKFLRLIFY
YTDASIILKAWRDFLYIRKDNIGDKYFAVDQAIMHSSHSQVRELMQTQPQLRGNDLGI
IRILAPSYLLDNPLSLGTNGNEHTGLRTVILQALPEPSQKIDFLGNLVEQSLLEAAKQ
GKLHIGNDLPKIILSILHQLVFQISLSEEEITASDSYIKGLALASLPNFINKYLLAIL
TAPKIRHRQYLTNRYKQSAKWASYFETGAQYQLNEHQIANTLFDMIHIAGTAGTSALL
GSVIGVLCLDNDLRNDVVSEVNAVWNGKKTLDPDALEQLTILNQVILETARLYPPVRF
VSQLTNEGGEVEIGEQKCPFQKGTRLLGSIFTANRDANRYQNPNDFDLTRNFSDILSW
NGEGHERACPGKSLSIGFIKIFCLHLFQNYQWDSITEVKWDFEKVTAVTPNNLVLQGF
AQRL

CYP228A1   Magnetospirillum magnetotacticum
           GenEMBL NZ_AAAP01002937 216..>1496 
           Gene = Magn3794
           34% to 107N1
MGPRPHARLVRRPPLPARARGHPVTGTALAPAPAGLAAAMRWEE
RVQRGAHPLVYPAIRALRHRGPVVRVPGIGVVVSDAATARAVLLDTEHFSKVGPGSPS
DLWTPVLGPSVLLNMEGADHARLRRALSGLFTPRAVRDLVAVSVPDVLAGLAPRLLAG
ERVDLVAETATMAGTVVCAMTGLPPTDSAVREAMTAAQSVVGLVRLHRRSLTPSQVRH
ARAVLARLSAPARDAYRAGDPATVPGRMRELGLSEDEALGAVGAFVLTGTETIQSFVP
RLVALTADTGWLDRLLAADPGAGPEAAALRGRVVEEALRVTAPTPAMLRSVRAATTVG
DVRVRAGDRVVIATISCCKDAGPFDPDAPVDPAVRHLWFGAGPHFCLGMPLATAQVDA
VLDALRPVAAAGRSLQVTDRAVARGVLIPAYRSLV

CYP229A1   Pseudomonas fluorescens PfO-1
           GenEMBL NZ_AAAT02000063 complement(5763..6863)
           Gene = Pflu1316
MDPIIAATHADPYPYYAELRAAGGLTFHHGLKLWVASSARAVCA
VLAHPDCRVRPVQEPVPKAIVDGMAGKVFGLLMRMNDGEAQRCPRSAIEPPLGLIDRE
EVGALVSARLITNDSDGLYKAMFRGPVCVVASLLGFTPAQARVISELTADFAACLSPL
SNDLQLAAAHRAAEQLRGYFIEMLADPNPFLADIRQRFVGNEEVLLANLIGLCSQTFE
ATAGLIGNALVALHRQPELRNASVDSLLAEVQRFDPSVQNTRRFMANSCEIDGVRLEA
GDVILVLLASANRDPALNENPDRFRVDRPNRRSFTFGSGRHQCPGQTLAMTIASATLT
EILARNIDPGRFTWHYRPSLNGRVPMFSEVQP

CYP230A1   Pseudomonas fluorescens NCIMB
           GenEMBL AF318063 58574..59938
           mupirocin biosynthetic gene cluster.
           Gene = mupO
MTSWEREVSRGAGNRQLPVVKGWPLLGSALALIRNPLGFLQTTR
STYGDVYRVKAAHMNFVVLAGMEANRFVADKGKDCFVSSGFWEATLQEMQCPHSFIGV
DGDAHRFQRNLMKPLFSKSAFNERIPMLAQIFTDTLQARYGVDQKVSALFRHVLSQQI
GGSLQGYQPTPDEVEALMRYQNTAMNVCALKKWPRLALRLPGYRAAKKQVQALADRII
ESERTQEQTQGYFQTLKEKGQMVQPQWFTPGDMRNHAIISYLAGIDTVGATLSFMLLE
LFKQPHLHQALRDEVDACFSQGLPDADGLENMETLKNFIREVMRLYPTAYAVRRTRRK
DFEFQGYSIDKGQDIILFTTANHTDPAWFKNPQVFDITRYEEPRLEHRASGAWAPFGR
GPHTCIGAGLANILLSLNLALFLYHTDLRPACKLSDIKMDFSNPAAGLSERFAISFTPRNRP

CYP231A1   Ferroplasma acidarmanus Archaea; Euryarchaeota
           GenEMBL NZ_AABC02000007 complement(32352..33461)
           Gene = Faci1014
           38% to 109A1
MEHDVFQYYRKMRKESPVHFNNDTGSWDVFDYKSVYFVLMNPDI
YSSDPSYAGNIPENRQGPGASFITMDNPDHKELRNVTTPYFLTSKITGYRDMIESTSK
RLMEGINKNSDFIRDYAVMLPVTVISELLGVPENDRSKFKEWSDYIIGNRSDAGFQDL
NRYMYSTMAEIFKTNTEDNIISTINKGLFHSEPLSINQKIGYVMLLVIGGNETTTNLI
GNMVKVLSEHPEIADKLRQEPELKKGFIEETLRYYSPIQFLPHRFAARDSVLNGQEIK
KGQRLSIWLGSANRDGAKFEDPDTFNMERQNNDHLAFGMGIHMCLGSPLARLEAEIAL
NDILNKFKHVKINAEKTSMLKNPMVYGFSTMQLDD

CYP232A1   Ferroplasma acidarmanus Archaea; Euryarchaeota
           GenEMBL NZ_AABC02000015 12150..13295
           42% to 109B1 40% to 119A1
           gene = Faci0565
MEIPTYKEEPFEWYREMRKNSPVYREGNMIHIFKYNTISKILSD
HQNFSSQFRDLLGEEMAAMLNEKTTPSILLLDPPLHTTLRGLVGSAFTPRSIELFEPR
IREIARMLAHAIVEKENSDIVSDLSYQLPIRVISEMLGVPESDSEIFRDWSDKLATSL
GRGPDIETQYDMADYFYKKIDRNSKGNNLISRLSTVEMDGRKLSDKEIAGFAILLLVA
GNETTTNLITNAILSLYDHPEIYNEMRKTPSLIPGVVEETLRYRSPVQSTRRYSKIDT
EIEGEEILKNDILALYLGSANRDEEAFEDGESFNPYRKEKRHMAFGQGIHFCLGAPLA
RLEARIALEEFSKAVPGFEIEKPSPDDRIDSDIMYGFRKLNLKVNRS

CYP233A1   Gloeobacter violaceus
           GenEMBL NC_005125 complete genome
           complement(2058447..2059673)
           40% to 107X1
MSALPPPRFNPFDSEFRQDPYRVYAHLRVAAPIHRSLGMWVLTR
YADVLAVLKDPHFSSSQIPLAVRQRSERPDQAQSHPLARLAAKSIVFTDEPDHTRLRH
LVVRAIKRRTPEQEQAHLTRIASALLERVGPKGRMDAVADYAERLPLQFMAESMALPP
DSWQTVRDWTHQLRYLLEPGLMGRGDFERVQAVLDEVIAFFEDMLAVRRQQPGDDLIS
ALDAAHREAQADRLSDEEIVYCCIMMFVAGHETTRSLIASGLLALLQHPEQLAYLRMH
PERMGAAVTEMLRYESPLQQTKRRATAAVAVGGRTIQPQEQVLLCLGAANRDPARFEQ
PDRFDITRTDNGHLAFGQGMHHCLGAALAQMEAQVALRVLLERFANLTLQDTPEWLEH
SFILRGLKTLPVQWDR

CYP234A1   Photorhabdus luminescens subsp. laumondii TTO1
           GenEMBL NC_005126 complete genome
           complement(4894114..4895217)
           locus_tag = plu4183
           very poor match
MMNVLINEYKKKMDSVRLGDPERKGFFYDAKQAIWHCYSYDICS
YFLNSDYVTKKKLSIPLEIFSASDQSRVARFILYLNNSLIFNDDKYNTDAVSFIRGKF
NEMNFEVIANDLLSPLKQCDLLTAKHLRGVNNLLAASLVGLKASAFFSAHALNVGMFF
DGSMSGRAHFVSIAESFIAIYQQVLRQITINGGAEDVIHIEKFVADLSVTFIAAHETT
MQLIIATFLYIKSHVITVTENNIKSIVTETYRLSSPVLAVNRVFKERLIYKNSCFNKG
DRVLFYTGLANFDATVFDHPYQFQLDREGCPLSFGVGVKKCIGMNIAIHFTCQLITKI
LSCYQLDDVEIHEVTVGSLAIGCSKFTLKISKK

CYP235A1   Streptomyces antibioticus 
           GenEMBL AJ002638 184..1389
           35% to 131A1 no heme sign.
           Gene = oleP1
MEDSELGRRLQMLRGMQWVFGANGDPYARLLCGMEDDPSPFYDA
IRTLGELHRSRTGAWVTADPGLGGRILADRKARCPEGSWPVRAKTDGLEQYVLPGHQA
FLRLEREEAERLREVAAPVLGAAAVDAWRPLIDEVCAGLAKGLPDTFDLVEEYAGLVP
VEVLARIWGVPEEDRARFGRDCRALAPALDSLLCPQQLALSKDMASALEDLRLLFDGL
DATPRLAGPADGDGTAVAMLTVLLCTEPVTTAIGNTVLGLLPGQWPVPCTGRVAAGQV
AGQALHRAVSYRIATRFAREDLELAGCEVKSGDEVVVLAGAIGRNGPSAAAPPAPPGP
AAPPAPSVFGAAAFENALAEPLVRAVTGAALQALAEGPPRLTAAGPVVRRRRSPVVGG
LHRAPVAAA

CYP236A1   Microscilla sp. PRE1 plasmid pSD15
           GenEMBL NC_002806 40616..41776
           32% TO 109A1 C-TERM
MKKDLIPDPFEKTREAAGYGEMNDQNDPVTMILRLKDVRKCAHN
FKTFQSGARPGRIVVPSEVSIRDTRQIPFEVDPPEHTDYRALVEPWFKRPLEAEYREK
LSQQIGYIVEERLARDAVEVVEEFSLPLQSRALTLLLNIPIEEAETWIKWGTHVFRSE
DSPVDGDKAKILYDYIDQQIDRALEKPGEDLYTVLLNSEINGKKLSREEVKGVMILTF
AGGRDTVINAVTNSVAYFAVHPESLELLRKEPEITGRAVEELIRYFAPLTHMGRVVTE
DTQVCEYAVKADSRISLVWASANRDSSVFEKPNEVVLDRKINPHVSFGFSHHNCLGAT
HARQIMHILLKTLAEKVGSIEIQEHEDNIETWGEFERKVGYDRLKVQFNPLQ

CYP237A1   Pirellula sp.
           NC_005027 complete genome 6102783..6104327
           34% TO 184A1 C-TERM
           gene = cypX
           locus_tag = RB11252
MRNGTSYLQNFFPGYRRLSRLPKQCLAINPFAGDCMPSRVRLLA
PRSDRPTQPFPHRWNYEDPVRILETYFWKADEEQGPGRHNRYLDVPGFAPVLVTRDPG
MIRAIATATGDREGQFDRDTLPSVGIARATGTDTLLYANGAEWKKQRKIAACPFGKTT
LFQPEQFCEFADTFRETVRGRIDVLRQHLTASGKKTVDIQLEPEVKVVMLEMLTNNFF
GADISYEELREKYVPALERVIDHIVKDTVKNRLGIPWRKFPSVSDRIVRAKADDATFE
ELTQRILVPRGEKKALWKQFKSDAPDAKLISNLKVFLAGALEATTSYATWAISHLARH
PDAQEKVFEEVKDIDVYTPEILAGAKYLRAVLDETLRLTPSLYFLPRRATADTWVTSA
DGRKMFIPWGTHLLLDVWHANRHEDHWGVQVSGYPANEFEPDRWRILAEWGRATKDTL
HFGFGHGPRVCPGKHLGELEVGLTVGALVKTFRFQSESPENLARAGVSTKPADGTRVC
MSLRLS

CYP238A1   Pseudomonas putida KT2440
           NC_002947 2211866..2213101  
           26% to CYP101A1 30% to 107X1
           locus_tag = PP1955
MEILDRPQAPSDFNPMSEQSFRDPASICQRAREETPVFFYAPLG
VWMVTRREDAERVLSEWETFSSLANSPNVPEEFRSRFAPSVMADSIVAIDPPRHTQAR
NVIQRGFMKPKIDPLEPIIEQRAHEIIDRFAGESGTEIMNNYCLELTTRTLMALYDLP
LEDRPMFERIRDVSIKVLASVYEPMQEPEKSRVWNEYVSGYEYFYQLVEQRRNSDARD
IISTMASQKDNQGNPALSTERIALHLVEIAFAGTDTTAQMMANAILFLDSHPEALAAA
KADKTLWSRVFEETVRRRPSAPFAGRITTTEVEIQGVKIPAGSPVWVSLAAANTDPRH
VGCPMNFDINREAPQDHLAFTKGRHTCPGAPLARLQGATGLRVLFERLPELKVVPDQP
LNFAPMALLPVRLSLQVIW

CYP239A1   Pseudomonas aeruginosa strain SG17M
           GenEMBL AF440524 34312..35472
           Integrated gene island PAGI-3(SG).
           38% to 194A1 96% 14 diffs to CYP239A2 AJ311159
           gene =ORF SG16"
MKDVNEVARNFDFHGEALDDIFDTYSTLRHGCPVGRSENYGGFW
FLTKSDDIFAAEQDPEAFSVYPSMMVPSVSEGIQLPPIDIDPPEHTAYRRILLPLFTP
QELKKLEQPIRDTARKLAEEFAKEGSGADASYHYSRPLPTIIFSRLAGYPEQDWPKFD
KWVDDIIYERVEKPEVANQASKDVFSYFENLLDNWKDDSESANLIDYLCRAKINGRPL
TRDELLRYCYLLFLAGLDTTAWSIRAGLWYLANNPADQQKLRDNPDLIPLACEEFLRT
LSPVQVMARTCLKDTVIRDQEIKAGERVMLVFGAGNRDEEVFPNPDKIDIERQENRHL
AFGGGIHRCLGSNLGRRELVVGIEEFLRAVPQFKPADPSEKWHGVGPLKLAF

CYP239A2   Pseudomonas sp. KIE171
           GenEMBL AJ311159 4194..5354
           isopropylamine degradation gene cluster (ipuABCDEFGH genes) 
           38% to 194A1 96% 14 diffs to CYP239A1 AF440524
           gene = ipuD
MKDVNEVARNFDFHGEALDEIFDTYSTLRNGCPVGRSENYGGFW
FLTKSDDIFAAEQDPEAFSVYPSMMVPSVSEGIQLPPIDIDPPEHTAYRRILLPLFTP
QELKKLEQPIRDTARKLAEDFAKEGTGADASYHYSRPLPTIIFSRLAGYPEKDWPKFD
KWVDDIIYERVEKPEVANQASKDVFSYFENLLDNWKDNGESANLMDYLCRAKIDGRPL
TRDELLRYCYLLFLAGLDTTAWSIRAGLWYLANNPEDQQKLRDNPELIPLACEEFLRT
LSPVQVMARTCLKDTVIRGQDIKAGERVMLVFGAGNRDEEIFPNPDKIDIERQENRHL
AFGGGIHRCLGSNLGRRELVVGIEEFLRAVPQFKPADPSEKWHGVGPLKLAF

CYP240A1v1   Bordetella bronchiseptica
             NC_002927 3943708..3944865 
             extremely poor match may not be a P450
             locus_tag = BB3721
             100% to B. parapertussis 98% to B. pertussis 7 diffs
MIADTARQHRGDIMQPADPLEAVAHPDPYPYYAALARERPFYHD
DRLGLWVAAGPQAIRAVLTCPAARVRPPGEPVPAALGAGPAAQMFGRFIRMNDGAVHE
RLKPMLTAYLTQRTAADLAEPAWPAIGNDPAQVDRYLYQAPVHAQACLMGLPDEVAAS
CAREIEAFMAACRPGADAAAVARADQAAQALQARMLAHLRAARGDAALGVLRRLALAG
GVEADALAANLAGLLLQSCEAGAGLLGNALVHAGRLSPAAAAAAPDLLHTCVEIVTHV
ARHDPPLHNTRRFLAAPATLLGQSVPAGAGILVVLAAAHALAEGAWPWTFGAERHACP
GRTPALLHAAQALAHALRHGVDAPALARRVRYRPLPNARVPRFHFPPGDTP

CYP240A1v1   Bordetella parapertussis
             NC_002928 3527249..3528406
             locus_tag = BPP3270
             100% to B. bronchiseptica

CYP240A1v2   Bordetella pertussis
             NC_002929 2545572..2546720
             locus_tag = BP2405
             98% to CYP240A1v1 7 aa diffs
MIADTARQHRGDSMQPADPLEAVAHPDPYPYYAALARERPFYHD
DRLGLWVAAGPQAIRAVLTCPAARVRPPGEPVPAALGAGPAAQMFGRFIRMNDGAVHE
RLKPMLTAYLTQRTAADLAEPAWPAIGNDPAQVDRYLYQAPVHAQACLMGLPDEVAAS
CAREIEAFMAACRPGADAAAVARADQAAQALQARMLAHLRAARGDAALGVLRRLALAG
GVEADALAANLAGLLLQSCEAGAGLLDNALVHAGRLSPAAAPDLLHTCVEIVTHVARH
DPPLHNTRRFLAAPATLLGQSAPAGAGILVVLAAAHALAEGAWPWTFGAERHACPGRT
PALLHAAQALAHALRHGVDAPALARCVRYRPLPNARVPRFHFPPGDTP

CYP241A1   Enterococcus faecium
           NZ_AAAK01000185 complement(2963..4222) 
           Gene = Efae1119
           36% to 152B1
MKEVPVVDIKITDLKKLYQKGYNMLEELRHEADAPVVKAKIFNK
EAITIYGSSAAKVFYDPRNFKRKGAMPKLVLKTLFGQGGVQTLDGAAHHHRKNIFMDL
MTPERMEDYHRILDKNLTQALEAQHGQFELFDLSKMVFFTSICEWAGINLSAISKDEV
EKLAEYQISMISGTFTSPIDHIKGVENRKKSEKWAQGLIEEARQNPVAGKENVALYAF
ANATDLDGQLLPLEVAAVELLNIIRPTVALTVWAALMGHALFSRPDLYQQLKNDFSTL
QDPFIQEMRRYYPFFPMLPAISLKEVEVDGYRIPEGSWVILDLYGTDHDERTVEAPDS
FMIKRYVGKAKDISYKEEYEMIAQGGGNFRQMHRCAGEWITLHSLRVFSDQLVNKFEF
SVPEQDWTIPFNQFPTYPNSRALLYKN

CYP242A1   Kitasatospora griseola
           GenEMBL AB048795 2479..3729
           36% to 107P1
MADLETKFPRYELISSGKYVDRIPELHELREKSPIAWVPVMDAA
FLTRHADIVRVLKDHRMAPANLTQGIRLLSPEQQEELEPLSSAVKKWMGHTVPADHQR
FIGLLKRYFTPAMIDRMRPRVRQLSHELLDAVEPAGRMDIVSDIAYPLPACVIAEMLG
VPMDNRAQLLAWSADIGAIAEIVSYDRLMECQRSLLAMQDFVLEVVKERRAEPKDDLI
SMFVAAEREGLVSEAEILSNCVMLLFSGHETTGGLITSGLVQLFDHPDQLELLKSDPD
LMPGAVEEMLRLAGPASVISRVSTEPVEVAGSSIRSGAAVPPGADGGKRDPRVFEDPD
RLDATRRPNDHLAFATGMFYCLGAALARMEADEFFRILLDRFPDVNPGYETPDWQPVL
LISRRLKTLPVNLRGVGGSGAGDE

CYP243A1   Mycobacterium avium
           AF232829 complement(389..1609)
           38% to 222A1
MTPTRSTSTNWPSTPNCGNDVRSRGTRTTAGSGSSAATTPSAKP
PQRRHFRPQSTSRTPQTAWTTRARWASRDPEGQPALGLGEVDGPYHQALRHALAPFFS
PGAVEKLNPFMEQSAHWFLDQQITTGQMDLVLDYASPVPAILTMKLMGLPYDNWRLYA
NLFHSVMAVSQDSDEYAAAIAKVPAMMHEVLDYAATRRAKPEEDLTSFLIRFEFDGHR
LTDEQLLNILWNLIGGGVDTTTSQTALTVLHLGTHPDLRQQLIDHPELYRTATDEFLR
YFSVNQTLSRTVTHDVVLAGQRLRKNDRVVISWLSANHDENEFDRPDEIILDRAPNRH
VAFGLGPHRCIGSHLARLMSEVMVRAVLXRIPDYQVDVENVHQYLGNPSMTGLGQLPV
TFAPGKSRKTLRPW

CYP244A1   Streptomyces sp. TP-A0274
           GenEMBL AB088119 complement(5410..6594)
           staurosporine biosynthetic gene cluster
           31% to 107B1
           gene = staN
MTDMPVDPGPFDCMPELLAAARVAPVVRIPYLEEHAWVVCDPEL
VRTALTHPKMAKDITLVPQFMRKPGLMVGSQPPPEYARAMIMSDGEDHARIRRVHQPV
LSPRNTQRWGERVGVKVGGFLDELEQSRASDSAEVDVVTDYTHRVPLAFISEMLGLPL
EAERRLRSITDVMLYSSDYPARQEAVGALFGAVESWVQNPAPLRDGVITGFLAAADGP
DKVTEGEVIVWTVGMIITGYETTGSLISASLYEALRRPPEERPGTDEEIKSWIEEALR
VHPPFPHPTWRFPTEDIELGGYLIPKGAPVQVSIAAANRQPGEGADSFEAARGGHGHL
SFGLGMHYCIGASLVRLEAQIAVREFLRRFPKARLSDGSAVQWESEWMIRRLSALPAVLN

CYP245A1   Streptomyces sp. TP-A0274
           AB088119 13260..14513
           staurosporine biosynthetic gene cluster
           38% to 107P2 53% TO Lechevalieria (10860..12053)
           gene = staP
MASATLPRFDLMGWDKKDIADPYPVYRRYREAAPVHRTASGPGK
PDTYYVFTYDDVVRVLSNRRLGRNARVASGDTDTAPVPIPTEHRALRTVVENWLVFLD
PPHHTELRSLLTTEFSPSIVTGLRPRIAELASALLDRLRAQRRPDLVEGFAAPLPILV
ISALLGIPEEDHTWLRANAVALQEASTTRARDGRGYARAEAASQEFTRYFRREVDRRG
GDDRDDLLTLLVRARDTGSPLSVDGIVGTCVHLLTAGHETTTNFLAKAVLTLRAHRDV
LDELRTTPESTPAAVEELMRYDPPVQAVTRWAYEDIRLGDHDIPRGSRVVALLGSANR
DPARFPDPDVLDVHRAAERQVGFGLGIHYCLGATLARAEAEIGLRALLDGIPALGRGA
HEVEYADDMVFHGPTRLLLDLPDAA

CYP245A2   Lechevalieria aerocolonigenes
           GenEMBL AF534707 complement(10860..12053)
           36% to 107P1
           gene = rbmE
MKPFDLKAFTGADLADPYPVYREYLTGDPVHHNGEAWYVFGYDG
VAHVLTSRDYGRRGPGGRATPIPPSHDTLSRIVENWLVFLDPPRHTALRSLLAKEFSP
AVVTGLRERVRKIAGELLAGLGDAGEIDLVEDFAAPLPILVISELLGVPARLRSWFRR
CAVDLQEASTARATRNPGALARADGAASELVEFFGGELGTRKPDDEDLVALLVNAQRR
GEALTDEEIVSTCVHLLTAGHETTTNLISKSVLALLANPAAAAEPLAGLDVTPQVVEE
LNRFDTPVQMVTRWAHQDTALGGKPIRRGDKVVLVLGSANRDPAAFAEPDRLDLRRDS
RRHCGFGLGIHYCLGAALARTEAEIGLSVLFTNFPGLRLGGEPVRYADDLVFHGPARL
PMLTR

CYP245A2   Lechevalieria aerocolonigenes
           GenEMBL AB090952 15478..16671
           rebeccamycin biosynthetic gene cluster
           gene = rebD  
           100% to AF534707 rbmE
           100% to Saccharothrix aerocolonigenes rebP

CYP245A2   Saccharothrix aerocolonigenes 
           GenEMBL AJ414559 15358..16551
           gene cluster for rebeccamycin biosynthesis.
           gene = rebP
           36% to 107P1, 100% to AB090952, AF534707

CYP246A1   Streptomyces acidiscabies
           GenEMBL AF393159 537..1724
           40% to 105M1
           gene = txtC
MESPATQVDPANSPLEPYHIYPEAKSCPVAKVGLWNGTPAHVFS
GYEDVRTVLQDRRFSSDSRRPNFTELTPTLQSQAAAPPFVRTDNPDHRRLRGTIAREF
LPKHIELLRPAIREIVQGVLDGLAETAPPQDMLEAFAVPVASATVFRLLGIPAEDRAL
LTRCVKGVVSAVGSEDEGAEVFRTLGEYIGGLVQDPSELPEDSLIRRLVTGPYQEKQL
TFHETIGVILMLIVGGYDTTASTISLSLVSYALQPEKFSVVHEHPERIPLLVEELLRY
HTVSQLGLGRIATEDVEVGGVTVRAGQMVVAALPLANRDESVFPNPDELDFDRPSVPH
VGFGYGPHQCVGQALARVELQEAIPAVIRRLPGMRLACALEDLPFRHDMATYGIHELPMTW

CYP247A1   Actinomadura verrucosospora 
           GenEMBL AF411574 1..>954 runs off end
           40% to 162A1
MRARAPLHHQVLPDGREFWSVTRYDDVCRVLGEHQRFTSERGTV
VTHLGVDDVAAGTLLTSTDPPRHTLVRRAIGARLTARAVAPWRERIPERDWDELVQLT
AMVTAPSDPHFRHGSEAATLAIAHHELVTYVKEWAARRRSAGGDDGSLLDHLMTVRVA
GAPLTDEEIALDGYSILLGANVTTPHTVSGTVLALIERPEQFGKVQADPSLVPNLVEE
GLRWTSAACNFMRYAVDDVRIAGGTIPARGAVVAWIGSANRDESQFADPHTFDVTRNA
SRQVAFGYGPHYCVGAPLARLTLRVFFKELLRRFGSLSSGGS

CYP248A1   Micromonospora echinospora
           GenEMBL AF497482 72606..73799
           gene = calO2
           calicheamicin biosynthetic locus
           34% to 107H1 
MTAFDPTDADVRRDPYPSYHWLLRHDPVHRGAHRVWYVSRFADV
RAVLGDERFARTGIRRFWTDLVGPGLLAEIVGDIILFQDEPDHGRLRGVVGPAFSPSA
LRRLEPVIAGTVDDLLRPALARGAMDVVDELAYPLALRAVLGLLGLPAADWGAVGRWS
RDVGRTLDRGASAEDMRRGHAAIAEFADYVERALARRRREGGEDLLALMLDAHDRGLM
SRNEIVSTVVTFIFTGHETVASQVGNAVLSLLAHPDQLDLLRRRPDLLAQAVEECLRY
DPSVQSNTRQLDVDVELRGRRLRRDDVVVVLAGAANRDPRRYDRPDDFDIERDPVPSM
SFGAGMRYCLGSYLARTQLRAAVAALARLPGLRLGCASDALAYQPRTMFRGLASLPIA
FTPGG

CYP249A1   Rhodococcus ruber
           GenEMBL AF333761 12042..13244
           Chauvaux,S., Chevalier,F., Le Dantec,C., Fayolle,F., Miras,I.,
           Kunst,F. and Beguin,P.
           Cloning of a genetically unstable cytochrome P-450 gene cluster
           involved in degradation of the pollutant ethyl tert-butyl ether by
           Rhodococcus ruber
           J. Bacteriol. 183 (22), 6551-6557 (2001)
           gene = ethB
           37% TO CYP217A1
MTLSLATAQERYATDADVFAHDTLVDPYDTYRSLRDIGRVSYMT
RYDTWALTRYDEVRHALGDWQTFSSAQGIGMSTALNEAWKDFAPCKDGADHLPMRKLM
MQDLGPKAAAAYKEKIQQAAVTLVEELLDRREFDAVLDFAQMMPMRVFMEVLGVEPDI
EQRRTMLHWGTDTYNCAAPDGLYDDTLPSMDKLYSWALENITPETAREGSVAASTWES
VERGDITDVQAVATLAAYVTAGLDTTAGTLGNTIAQFAANPDQWAIVRDDPKTIPGAI
LEGIRFDSVAQWFTRVTTRDVEYDDIVIPAGSRTYHSYAAANRDERHYRDPDSFDVLR
NPTDHVGFGYGPHMCVGKSVSNTEMIALWTELGRRVDRIEQIGPKKQHINNLIRSLDS
LPVRIYPK

CYP250A1   Arthrobacter aurescens
           GenEMBL AF146701 
           32% TO 219A1 N-TERM ONLY
MKEPLDFADPTLYQNPVPAFNKMREEHPVFWSDSAGSWVVSRHA
DVVRVLNNLEDAQASLFKINDYAEQCPFGKGTAISRGIENALVTTDLPDHPRLRRHTA
PLLTRRSVERDYAETVEQTVIALLEGIEEDTRFDVLDSISVPLPLAVVTKLIGFDAED

CYP251A1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           38% to 183A1 and 171A2
           clone name SP0759

CYP252A1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           39% to 197A1
           clone name SP0812

CYP253A1   Streptomyces peucetis
           No accession number
           Niranjan Parajuli
           Submitted to nomenclature committee Nov. 2, 2003
           36% to 197B1 
           clone name SP0913

Unidentified fragments

Rhodobacter capsulatus 1st sequence from a genome project
Rhodobacter capsulatus 2nd sequence from a genome project
Rhodobacter capsulatus 3rd sequence from a genome project 32% id with U08223

>AF071147 Streptoalloteichus hindustanus cytochrome
61% to 105C1 59% to AF040570 CDS 2652..3842
LLIAGHETTANMLALGAFALLEHPEQLAELRANPDLMPGAVEEL
MRYLSIVHIGPVRTAVADVEIEGQLIRAGESVTVSVPAANWDPAKFPEPERLDLTRRT
SGHLAFGHGVHQCLRQNL

>CYP? Streptomyces noursei putative P450 hydroxylase gene, partial cds.
GenEMBL AF071516 CDS complement(85..>519)
function="may hydroxylate a macrolide antibiotic polyketide moiety
C-term only 55% to 107A1
WTTPTRWSCSAPSLICLPRHGRNTAHRRTSRSHHPGRARRHPDR
DTLIPARSTVFIAGAAANRDPQKFPNPDTFDITRNTQGHLAFGYGVHHCIGRPLAQME
GEVAITALLRRFPHLHLTTPSQNLTWRRSFLRGLTALPVTLN

>L76374 Mycobacterium avium paratuberculosis 39% identical to 107B1
483 LIFTDPPRHRQLRKLINSGFXXRRVSVLEPKIRKIVXXILDGIEXGAVHEFTEQITAPLP 304
303 TRMIAELIGAPPDDWEQFRAWSDAATGTADPEIELDPAVAAGQLYEYFQRLIAARRARPR 124
123 ADLLSVLAEAEIDEHRLTDEDLLNFAFLLLVAGNETTRNLI 1

Rhodococcus rhodochrous
Swiss P31718 (20 amino acids)
Eltis L.D., Karlson U., Timmis K.N.
Eur. J. Biochem. 213, 211-216 (1993)