x
This page was last modified Feb. 14, 2003.
Plant P450s that have appeared since the 1993 P450 nomenclature update.
Part D of the bibilographic P450 documents. These files were broken into
five parts to reduce the download time for each part.
This includes references that were incomplete and duplications
of sequences that were already in the update. If a sequence
is assigned an accession number that was not in the old update
it is included in this list. Some expressed sequence tags (ESTs)
are also included from Arabidopsis thaliana and Catharanthus roseus.
This list was last modified August 29, 2001. (added 76J1
sequence to this file. This is not in Genbank)
Plant P450 families are numbered CYP51, CYP71 to CYP99. The numbers then jump to
701-726, because there are 51 plant P450 families. Many of the
sequences included here are PCR fragments or expressed sequence tags
that are quite short. These fragments have not been
assigned to families, unless a clear family resemblance was present.
CYP51 is the only family conserved enough to be identified as the
same family across kingdoms, including plants, fungi, animals and
bacteria.
In the Arabidopsis expressed sequence tags, some are from the C-
terminal and some are from the N-terminal or middle region of the
P450s.Clearly some are from the same sequence, but the relationship
cannot be known until the whole sequence is complete, or
until PCR primers from the fragments can be used to identify
which fragments are in the same sequence.
Note: at least one plant sequence has been reported that shows a P450 spectrum and
P450 activity, but the sequence does not appear to be a P450 family member based on
descent from a common ancestor. (GenEMBL D64052, tobacco, Biochim. Biophys. Acta
1308, 231-240 1996) This sequence when blastn searched shows highest similarity to
rRNA.
BLASTN-outcome:D64052 Tobacco mRNA for cytochrome P450 like seq. 10050 0.0
1emb|Z11498|MSRRN26S M.sativa 26S rRNA 1034 4.5e-311
So D64052 is not a P450 but a ribosomal RNA.
Nitric oxide synthases have a heme thiolate spectrum. A heme thiolate ligand is
not restricted to P450 family members. It is ironic that the name cytochrome P450
derives from a characteristic spectrum, but not all proteins with this spectrum can
be included in the family of cytochrome P450s. This family is now defined by
sequence, and not spectral properties.
Note: First 71D sequences are in GenBank 71D6 and 71D7 (see below)
51 Family
71A Subfamily
71B Subfamily
71C Subfamily
71D Subfamily
71E Subfamily
72A Subfamily
72B Subfamily
73A Subfamily
74A Subfamily
74B Subfamily
75A Subfamily
76A Subfamily
76B Subfamily
76C Subfamily
76D Subfamily
77A Subfamily
78A Subfamily
79A Subfamily
79B Subfamily
79C Subfamily
79D Subfamily
79E Subfamily
80A Subfamily
80B Subfamily
81A Subfamily
81B Subfamily
81C Subfamily
81D Subfamily
81E Subfamily
81F Subfamily
81G Subfamily
81H Subfamily
82A Subfamily
82B Subfamily
82C Subfamily
82D Subfamily
82E Subfamily
82F Subfamily
83A Subfamily
83B Subfamily
83C Subfamily
83D Subfamily
84A Subfamily
85A Subfamily
86A Subfamily
87A Subfamily
88A Subfamily
89A Subfamily
90A Subfamily
90B Subfamily
91A Subfamily
92A Subfamily
92B Subfamily
93A Subfamily
93B Subfamily
93C Subfamily
93D Subfamily
94A Subfamily
95A Subfamily
96A Subfamily
96B Subfamily
97A Subfamily
97B Subfamily
98A Subfamily
99A Subfamily
701A Subfamily
702A Subfamily
703A Subfamily
704A Subfamily
705A Subfamily
706A Subfamily
707A Subfamily
708A Subfamily
709A Subfamily
709B Subfamily
710A Subfamily
711A Subfamily
712A Subfamily
713A Subfamily
714A Subfamily
715A Subfamily
716A Subfamily
716A Subfamily
716A Subfamily
51 Family
CYP51 Sorghum bicolor
GenEMBL U74319
Bak,S., Kahn,R.A., Olsen,C.E. and Halkier,B.A.
Cloning and expression in Escherichia coli of the obtusifoliol 14
alpha-demethylase of Sorghum bicolor (L.) Moench, a cytochrome P450
orthologous to the sterol 14 alpha-demethylases (CYP51) from fungi and mammals
Plant J. 11 (2), 191-201 (1997).
CYP51 Triticum aestivum (wheat)
GenEMBL Y09291 (1655bp)
Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A,
Werck-Reichhart D
Optimized expression and catalytic properties of a wheat obtusifoliol
14alpha-demethylase (CYP51) expressed in yeast Complementation
of erg11Delta yeast mutants by plant CYP51.
Eur J Biochem 262,435-446 1999
CYP51 Triticum aestivum (wheat)
GenEMBL Y09292 (1231bp)
Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A,
Werck-Reichhart D
Optimized expression and catalytic properties of a wheat obtusifoliol
14alpha-demethylase (CYP51) expressed in yeast Complementation
of erg11Delta yeast mutants by plant CYP51.
Eur J Biochem 262,435-446 1999
CYP51A1 Arabidopsis thaliana
GenEMBL AC002329 Complete sequence
GenEMBL AC007127 comp(82241-84323) complete seq.
Contig 1783 of the TIGR Landsberg erecta sequences has 99% match
CYP51A2 Arabidopsis thaliana
GenEMBL AC007296 comp(52507-54167)
GenEMBL N65031 (EST fragment)
GenEMBL AA651059 (EST fragment) opposite end AA720360
These ESTs are similar but not identical to CYP51A1.
76% to CYP51A1
CYP51 Zea mays
GenEMBL T12664 (EST fragment)
CYP51 Oryza sativa (rice)
GenEMBL AB025047
Aoyama,Y., Horiuchi,T. and Yoshida,Y.
Cloning and characterization of rice sterol 14-demethylase (CYP51) gene.
Unpublished
CYP51 Pinus taeda (pine)
GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
BF610290.1 CYP51 N-term
MDFIQNIYVQAGLLILATLVLAKIVSSILGFGSSKNLPPMVPAWPIVGGLMKFLKGPIVMLR
EEYPKLGNVFTIKLLIKNVTFLIGPEVSQHFFKXPESDL
CYP51 C-term
LXHDVLAXXDVLYRCIKEALRLHPPLIVLLRSNHRDFTVTAKDGKDYVIPKGHVVATSPAFANRLPHIFKNPDT
YDPDRFVPGREEDKVGGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFELELISP
FPEIDWNAMVVGVKDKVMVRYRRRPLSVD*
71A Subfamily
CYP71A1 Persea americana (avocado)
PIR A44973 (40 amino acids)
GenEMBL M32855
O'Keefe, D.P. and Leto, K.J.
Cytochrome P-450 from the mesocarp of avocado (Persea
americana).
Plant Physiol. 89, 1141-1149 (1989)
CYP71A2 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL D14990 (1744bp) X71654 (1747bp)
Swiss P37118 (505 amino acids) PIR S36806 (505 amino acids)
Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
cDNAs sequences encoding cytochrome P450 (CYP71 family) from
eggplant seedlings.
FEBS Lett. 330, 169-173 (1993)
Note: clone name 154 also called CYPEG4
CYP71A3 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X70982 (1096bp) Swiss P37119 (365 amino acids)
PIR S36807 (365 amino acids)
Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
cDNAs sequences encoding cytochrome P450 (CYP71 family) from
eggplant seedlings.
FEBS Lett. 330, 169-173 (1993)
Note: clone name F151 also called CYPEG3
CYP71A4 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X70981 (1724bp) Swiss P37117 (507 amino acids)
PIR S36805 (507 amino acids)
Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
cDNAs sequences encoding cytochrome P450 (CYP71 family) from
eggplant seedlings.
FEBS Lett. 330, 169-173 (1993)
Note: clone name E138 also called CYPEG2
Incorrectly called CYP71A1 in Genbank entry
CYP71A5v1 Nepeta racemosa (catmint, source of catnip)
GenEMBL Y09423(1703bp)
Clark, I.M., Forde, B.G. and Hallahan, D.L.
Spatially distinct expression of two new cytochrome P450s in leaves
of Nepeta racemosa: identification of a trichome-specific isoform.
Plant Mol. Biol. 33, 875-885 (1997)
note: sequence is revised from original submission on 9/10/98
CYP71A5v2 Nepeta racemosa (catmint, source of catnip)
GenEMBL
Clark, I.M., Forde, B.G. and Hallahan, D.L.
Spatially distinct expression of two new cytochrome P450s in leaves
of Nepeta racemosa: identification of a trichome-specific isoform.
Plant Mol. Biol. 33, 875-885 (1997)
note: a second allele
CYP71A6 Nepeta racemosa (catmint, source of catnip)
GenEMBL Y09424(1697bp)
Clark, I.M., Forde, B.G. and Hallahan, D.L.
Spatially distinct expression of two new cytochrome P450s in leaves
of Nepeta racemosa: identification of a trichome-specific isoform.
Plant Mol. Biol. 33, 875-885 (1997)
CYP71A7 Catharanthus roseus (Madagascar periwinkle) PCR fragment
GenEMBL X69779 (346bp)
Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
Isolation of cytochrome P-450 cDNA clones from the higher plant
Catharanthus roseus by a PCR strategy.
Plant Molec. Biol. 22, 379-383 (1993)
Note: sequence 7 from Fig. 2.
CYP71A8 Mentha piperita
GenEMBL Z33875 (2141bp)
Kang,M.H. and Choi,Y.D.
Molecular cloning of a genomic DNA for cytochrome P-450 oxidase
from Mentha piperita.
unpublished (1994)
CYP71A9 Glycine max (soybean)
GenEMBL Y10489 (1603bp)
Schopfer,C.R. and Ebel,J.
Identification of elicitor-induced cytochrome P450s of soybean
(Glycine max L.) using differential display of mRNA
Mol. Gen. Genet. 258, 315-322 (1998)
clone CP1
CYP71A10 Glycine max (soybean)
GenEMBL AF022157 (1838bp)
Siminszky,B., Dewey,R.E. and Corbin,F.T.
capable of catalyzing the metabolism of phenylurea herbicides
CYP71A11X tobacco
no accession number
Takashi Yamada
tobacco sequence 2
submitted to nomenclature committee 9/9/97
renamed CYP71AH1 only 46% to 71B38
CYP71A12 Arabidopsis thaliana
GenEMBL AC002340
T11J7.14
CYP71A13 Arabidopsis thaliana
GenEMBL AC002340
T11J7.16
ESTs H76866, AA605540
CYP71A14 Arabidopsis thaliana
GenEMBL AF069716 10000-14000 region
GenEMBL AC005964 comp(3688-6807)
67% identical to CYP71A13
no ESTs
CYP71A15 Arabidopsis thaliana
GenEMBL AF069716 16000-19000 region
GenEMBL AC005964 comp(1066-1380) partial seq.
no ESTs
CYP71A16 Arabidopsis thaliana
GenEMBL AB022210 comp(26631-24211)
64% identical to 71A14 ESTs AA395422, T43806
CYP71A17P Arabidopsis thaliana
GenEMBL AB017065 comp(19000-21000 region)
64% identical to 71A14
clear pseudogene, missing large regions including I-helix
CYP71A18 Arabidopsis thaliana
GenEMBL AC007296 83847-85677
86% identical to 71A12
no ESTs no GSSs
CYP71A19 Arabidopsis thaliana
GenEMBL AL049608
join(11443..11829,12066..12542,12626..12907,13106..13432)
gene T9E8.30 64% identical to 71A16 no ESTs no GSSs
CYP71A20 Arabidopsis thaliana
GenEMBL AL049608
join(21221..21598,21753..22253,22331..22612,23485..23811)
gene T9E8.50 88% identical to CYP71A19 no ESTs no GSSs
CYP71A21 Arabidopsis thaliana
GenEMBL AL049659 comp(61576..62187,62279..63139)
gene T29H11.160
also U31288 fragment at end of another gene and GSS B25921 no ESTs
CYP71A22 Arabidopsis thaliana
GenEMBL AL049659 comp (64631..65242,65328..66188)
gene T29H11.170 EST N38590
CYP71A23 Arabidopsis thaliana
GenEMBL AL049659 comp (67262..67861,68005..68856)
gene T29H11.180
CYP71A24 Arabidopsis thaliana
GenEMBL AL049659 comp(70246..71784)
gene T29H11.190
Genbank translation has a retained intron before the I-helix
CYP71A25 Arabidopsis thaliana
GenEMBL AL049659 comp (73216..73830,73929..74786)
gene T29H11.200
ESTs T22148, AA395671, AI100632
CYP71A26 Arabidopsis thaliana
GenEMBL AL049659 comp(76207..76818,76952..77809)
T29H11.210
CYP71A27 Arabidopsis thaliana
GenEMBL AL022224
F1C12.160a (parts from two genes are represented as one gene)
this is the first gene
61% identical to CYP71A20
note formerly 713A1
CYP71A28 Arabidopsis thaliana
GenEMBL AL022224
F1C12.160b (parts from two genes are represented as one gene)
this is the second gene
60% identical to CYP71A20
note formerly 713A2
71B Subfamily
CYP71B1 Thlaspi arvense
GenEMBL L24438 (1648bp)
Udvardi,M.K., Metzger,J.D., Krishnapillai,V., Peacock,W.J. and
Dennis,E.S.
Cloning and nucleotide sequence of a full length cDNA from Thlaspi arvense
that encodes a cytochrome P-450.
Plant Physiol. 104, 755-756 (1994)
CYP71B2 Arabidopsis thaliana
D78605 (502 amino acids) also AC007357 31915-33510
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-48 nearly identical to Z18072 and Z35218 ESTs
CYP71B3 Arabidopsis thaliana
D78602 (501 amino acids) also AB024038 COMP(43851-45465)
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-13-1
Contig 885 of the TIGR Landsberg erecta sequences has 100% match
CYP71B4 Arabidopsis thaliana
D78603 (504 amino acids) also AB024038 comp(78016-79595)
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-13-6
same as EST T21833, AI100749 GSSs B12539, B10642
CYP71B5 Arabidopsis thaliana
D78601 (498 amino acids) also AL132958
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-12
CYP71B6 Arabidopsis thaliana
D78604 (503 amino acids)
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
ESTs F15479, F14179
P450-23
identical to AC005967
CYP71B7 Arabidopsis thaliana
GenEMBL X97864 (1684bp) also AC007357 33975-41560
Maughan.J.A., Nugent, J.H.A. and Hallahan, D.L.
expression of CYP71B7 a cytochrome P450 expressed sequence tag
from Arabidopsis thaliana.
unpublished (1996)
full length sequence of 5 ESTs R65111, T44310, T04541, T04814, T44875
Contig 610 of the TIGR Landsberg erecta sequences has 100% match
CYP71B8 Arabidopsis thaliana
GenEMBL AB011485 27121-28820
CYP71B9 Arabidopsis thaliana
GenEMBL AC004136
47% identical to 71B7
no ESTs
CYP71B10 Arabidopsis thaliana
GenEMBL AB019233 comp(24311 - 22750)
71% identical to AC004136
no ESTs no GSS (1/13/99)
CYP71B11 Arabidopsis thaliana
GenEMBL AC006259 (94-702) partial seq.
GenEMBL AC005964 (66557-68105) whole seq.
BAC F21J6 from chromosome V mapping near 60.5 cM
69% identical to 71B1
ESTs Z33963, Z33677 GSSs B28673, B78204 and AQ011301
CYP71B12 Arabidopsis thaliana
GenEMBL AC006259 (4286-6376)
GenEMBL AC005964 (72227-73777)
BAC F21J6 from chromosome V mapping near 60.5 cM
92% identical to 71B11
CYP71B13 Arabidopsis thaliana
GenEMBL AC006259 (9294-10829)
GenEMBL AC005964 (76695-78230)
BAC F21J6 from chromosome V mapping near 60.5 cM
70% identical to 71B1
CYP71B14 Arabidopsis thaliana
GenEMBL AC006259 comp(30932-32475)
BAC F21J6 from chromosome V mapping near 60.5 cM
68% identical to 71B1
CYP71B15 Arabidopsis thaliana
GenEMBL AB016889 (54457-56024)
62% identical to 71B7
CYP71B16 Arabidopsis thaliana
GenEMBL AB024038 comp(13279-14849)
84% identical to CYP71B17
no ESTs no GSSs
CYP71B17 Arabidopsis thaliana
GenEMBL AB024038 comp(15932-17496)
84% identical to CYP71B17
no ESTs no GSSs
CYP71B18 Arabidopsis thaliana
GenEMBL AB024038 comp(18098-19609)
80% identical to CYP71B17
ESTs AA650762, T44224, AI099821 (2 diffs)
T44855 (3 diffs) GSS B25335
missing an internal 21 amino acid fragment and frame shift after
first 6 N-terminal amino acids. may be a pseudogene
CYP71B19 Arabidopsis thaliana
GenEMBL AB024038 comp(21194-22760)
ESTs H76241
60% identical to 71B2
CYP71B20 Arabidopsis thaliana
GenEMBL AB024038 comp(26044-27630)
94% identical to CYP71B19
ESTs T04186, T45449, T21193, AA585920 (1 diff)
T20987 (3 diffs) no GSSs
CYP71B21 Arabidopsis thaliana
GenEMBL AB024038 comp(31112-32720)
88% identical to 71B22
no ESTs no GSSs
CYP71B22 Arabidopsis thaliana
GenEMBL AB024038 36984-38609
88% identical to CYP71B21
no ESTS no GSSs
CYP71B23 Arabidopsis thaliana
GenEMBL AB024038 comp(40969-42839)
71% ident to 71B7
no ESTs no GSSs
CYP71B24 Arabidopsis thaliana
GenEMBL AB024038 comp(45837-47529)
80% identical to 71B3 no ESTs
GSS AQ011201 (5 diffs/178 = 97%) B96063 4 diffs/126 = 97% these
may be a related gene.
CYP71B25 Arabidopsis thaliana
GenEMBL AB024038 comp(75254-76832)
74% identical to 71B4
no ESTs no GSSs
CYP71B26 Arabidopsis thaliana
GenEMBL AB024038 comp(80407-82076)
68% identical to 71B9
very similar to Z33952, Z34037 (91% identical) but different gene
CYP71B27 Arabidopsis thaliana
GenEMBL AB007357 28180-29804
GSSs B11396, B21019 no ESTs
CYP71B28 Arabidopsis thaliana
GenEMBL AB007357 34549-36103
ESTs T20906, T76255, T14112, N65665, AI100027
CYP71B29 Arabidopsis thaliana
GenEMBL AB007357 36686-38241
similar to GSS B21027
CYP71B30P Arabidopsis thaliana
GenEMBL AL132958
Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs
(71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
82204-83671 missing N-term 80 AA not found between end of 71B5 and start
of this sequence probably a pseudogene
clone F4P12 from the EU Chr 3 project overlaps T04D02 and contains
two of the three new 71Bs and part of the third
CYP71B31 Arabidopsis thaliana
GenEMBL AL132958
Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs
(71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
84593-86302 GSSs AL092788 (clone T10J6) AL081333 (clone F2M19) No ESTs
clone F4P12 from the EU Chr 3 project overlaps T04D02 and contains
two of the three new 71Bs and part of the third
CYP71B32 Arabidopsis thaliana
GenEMBL AL132958
Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs
(71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
87497-89156 two in frame stop codons may be a pseudogene
clone F4P12 from the EU Chr 3 project overlaps T04D02 and contains
two of the three new 71Bs and part of the third
CYP71B33 Arabidopsis thaliana
GenEMBL AP001298 comp(479-2126)
CYP71B34 Arabidopsis thaliana
GenEMBL AP001298 comp(2977-4644)
CYP71B35 Arabidopsis thaliana
GenEMBL AP001298 comp(4867-6557)
CYP71B36 Arabidopsis thaliana
GenEMBL AP001298 comp(8161-9842)
CYP71B37 Arabidopsis thaliana
GenEMBL AP001298 comp(10654-12314)
EST Z27299
71C Subfamily
CYP71C1 Zea mays (maize)
GenEMBL X81827 (1890bp) X81828 (4352bp)
Frey,M., Kliem,R., Saedler,H. and Gierl,A.
Expression of a cytochrome P450 gene family in maize
Mol. Gen. Genet. 246, 100-109 (1995)
CYP71C1 Zea mays
GenEMBL AF004210 (1185bp)
Sisco,P.H.
agr(c94) random cDNA clone from Zea mays etiolated coleoptiles
Unpublished
CYP71C2 Zea mays (maize)
GenEMBL X81829 (1786bp)
Frey,M., Kliem,R., Saedler,H. and Gierl,A.
Expression of a cytochrome P450 gene family in maize
Mol. Gen. Genet. 246, 100-109 (1995)
CYP71C2v2 Zea mays
Sharon Potter
sequence b
submitted to nomenclature committee
CYP71C2 Zea mays (maize)
GenEMBL Y11404 (3130bp)
Gierl, A.
unpublished (1997)
CYP71C3 Zea mays (maize)
GenEMBL X81830 (1800bp)
Frey,M., Kliem,R., Saedler,H. and Gierl,A.
Expression of a cytochrome P450 gene family in maize
Mol. Gen. Genet. 246, 100-109 (1995)
CYP71C3 Zea mays (maize)
GenEMBL Y11403 (5057bp)
Gierl, A.
unpublished (1997)
CYP71C3v2 Zea mays (maize)
no accession number
Persans,M. and Schuler,M.
unpublished (1995)
note: Maize strain used in Schuler's lab = B73, Frey's lab used CI31A
CYP71C4 Zea mays (maize)
GenEMBL X81831 (1878bp)
Frey,M., Kliem,R., Saedler,H. and Gierl,A.
Expression of a cytochrome P450 gene family in maize
Mol. Gen. Genet. 246, 100-109 (1995)
CYP71C4 Zea mays (maize)
GenEMBL Y11368 (7466bp)
Gierl, A.
unpublished (1997)
CYP71C5 Zea mays
Sharon Potter
sequence a
submitted to nomenclature committee
55% to 71C4
CYP71C6 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
probable orthologue to CYP71C1 (79% identical)
CYP71C6 Triticum aestivum (wheat)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 4/30/2000
clone name N-2
probable orthologue to CYP71C1 (79% identical)
100% identical to 71C6 of Werck
CYP71C7v1 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
probable orthologue to CYP71C2 (76% identical)
CYP71C7v2 Triticum aestivum (wheat)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 4/30/2000
clone name N-3
probable orthologue to CYP71C2 (76% identical)
96% identical to 71C7v1 of Werck
CYP71C8v1 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
probable orthologue to CYP71C3 (78% identical)
CYP71C8v2 Triticum aestivum (wheat)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 4/30/2000
clone name N-4
probable orthologue to CYP71C3 (78% identical)
95% identical to 71C8v1 of Werck
CYP71C9v1 Triticum aestivum (wheat)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 4/30/2000
clone name N-5
probable orthologue to CYP71C4 (78% identical)
97% identical to 71C9v2
CYP71C9v2 Triticum aestivum (wheat)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 4/30/2000
clone name N-6
probable orthologue to CYP71C4 (78% identical)
97% identical to 71C9v1
CYP71C9v2 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
submitted to nomenclature committee July 23, 2001
76% identical to 71C4
clone C4-38
100% identical to Dr. Imaishis sequence
CYP71C10 Triticum aestivum (wheat) formerly CYP71H1
No accession number
Daniele Werck-Reichhart
55% to 71C4 but only 50% to 71C8, 56% to 71C11
clone name 71F8I2
submitted to nomenclature committee July 18, 2000
This sequence has been reassigned to the 71C subfamily
It is on the outskirts of the subfamily, but new sequences
force it to belong there rather than in a new subfamily.
CYP71C11 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
submitted to nomenclature committee Jan 6, 2001
58% identical to 71C7, 57% to 71C6 and 56% identical to 71C10
CYP71C-like Hordeum vulgare (barley)
GenEMBL AJ000231
Hess,W.R.
Analysis of randomly selected cDNAs from white leaves of the
albostrians mutant of barley
Unpublished
GQRMCPGMNLVNHFDWELPIGIESIDMTEVFGITIRRKEKLLLIPKSRL
68% identical to C-terminal of 71C4
71D Subfamily
CYP71D1 Catharanthus roseus
GenEMBL AY192573
Schroeder,J.
submitted to nomenclature committee
CYP71D2 Catharanthus roseus
GenEMBL AY192574
Schroeder,J.
submitted to nomenclature committee
CYP71D3X Arabidopsis thaliana
GenEMBL Z27299
62% amino acid identity to CYP71D1
this short EST fragment belongs to 71B37
CYP71D4 Solanum tuberosum cv. Datura (potato)
GenEMBL AJ296346
Michel Schneider
56.1% identical to CYP71D1
induced rapidly by Phytophthora infestans infection or wounding
(pesonal communication from Michel Schneider)
CYP71D5 Nicotiana tabacum (tobacco)
no accession number
Simon Warner
submitted to nomenclature committee
CYP71D6 Solanum chacoense (Chaco potato)
GenEMBL U48434 (1641bp)
Hutvagner, G., Barta, E. and Banfalvi, Z.
Isolation and sequence analysis of a cDNA and related gene for
cytochrome P450 from Solanum chacoense.
Gene 188 (2), 247-252 (1997)
CYP71D7 Solanum chacoense (Chaco potato)
GenEMBL U48435 (3107bp)
Hutvagner, G., Barta, E. and Banfalvi, Z.
Isolation and sequence analysis of a cDNA and related gene for
cytochrome P450 from Solanum chacoense.
Gene 188 (2), 247-252 (1997)
CYP71D8 Glycine max (soybean)
GenEMBL Y10493 (1800bp)
Schopfer,C.R. and Ebel,J.
Identification of elicitor-induced cytochrome P450s of soybean
(Glycine max L.) using differential display of mRNA
Mol. Gen. Genet. 258, 315-322 (1998)
clone CP7
CYP71D9 Glycine max (soybean)
GenEMBL Y10490 (1754bp)
Schopfer,C.R. and Ebel,J.
Identification of elicitor-induced cytochrome P450s of soybean
(Glycine max L.) using differential display of mRNA
Mol. Gen. Genet. 258, 315-322 (1998)
clone CP3
CYP71D10 Glycine max (soybean)
GenEMBL AF022459 (1691bp)
Siminszky,B., Dewey,R.E. and Corbin,F.T.
clone name 5/16
CYP71D11 Lotus japonicus
GenEMBL AF000403 (1641bp)
Szczyglowski,K., Hamburger,D., Kapranov,P. and de Bruijn,F.J.
Construction of a Lotus japonicus late nodulin expressed sequence
tag library and identification of novel nodule-specific genes
Plant Physiol. 114 (4), 1335-1346 (1997)
CYP71D12 Catharanthus roseus (Madagascar periwinkle)
GenEMBL AJ238612 (1682 bp)
Schroeder,G., Unterbusch,E., Kaltenbach,M.,
Schmidt,J., Strack,D., De Luca,V., and Schroeder,J.:
Light-induced cytochrome P450-dependent enzyme in
indole alkaloid biosynthesis: tabersonine
16-hydroxylase.
FEBS Lett. 458, 97-102 (1999)
Note: due to a mistake on my part the name 71D12 was assigned
to two sequences. The sequence of Schroeder has priority
Since it was submited and named earlier than Lupiens sequence.
CYP71D12X Mentha spicata (spearmint) Renamed as CYP71D18
GenEMBL AF124815
Shari Lupien, Rodney Croteau
Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
(mentha) Species
unpublished
submitted to nomenclature committee 1/24/99
50% identical to 71D7, 69% identical to 71D13
(-)4S-Limonene-6-Hydroxylase
Note: due to a mistake on my part the name 71D12 was assigned
to two sequences. The sequence of Schroeder has priority
Since it was submitted and named earlier than Lupiens sequence.
CYP71D13 Mentha X piperita (peppermint)
GenEMBL AF124816
Shari Lupien, Rodney Croteau
Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
(mentha) Species
unpublished
submitted to nomenclature committee 1/24/99
69% identical to 71D12
(-)4S-Limonene-3-Hydroxylase
clone name PM17
CYP71D14 Petunia hybrida (petunia)
no accession number
Hiromasa Imaishi
submitted to nomenclature committee June 4, 1999
58% to 71D6
IMT-5
CYP71D15 Mentha X piperita (peppermint)
GenEMBL AF124817
Shari Lupien, Rodney Croteau
Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
(mentha) Species
unpublished
submitted to nomenclature committee 1/24/99
69% identical to 71D12, 92% identical to 71D13
(-)4S-Limonene-3-Hydroxylase
clone name PM2
CYP71D16 Nicotiana tabacum
GenEMBL AF166332
Wang,E., Wang,R., Deparasis,J., Gan,S. and Wagner,G.J.
Isolation of a cytochrome P450 gene from tobacco
Unpublished
54% to 71D5 also a tobacco sequence
MQFFNFFSLFLFVSFLFLFKKWKNSNSQTKRLPPGPWKLPILGS
MLHMLGGLPHHVLRDLAKKYGPIMHLQLGEVSLVVISSPGMAKEVLKTHDLAFANRPL
LVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIKFF
RSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKEQDEFVQLVKKVSNLIEGFDVADIFP
SLKFLHVLTGMKAKVMNTHNELDAILENIINEHKKTSKSDGESGGEGIIGVLLRLMKE
GGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVEMMKNPSVFSKAQAEVREILRG
KETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNA
WAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRRICPGISFGLANVYFP
LAQLLNHFDWKLPTGINPRNCDLTEAAGAACARKNDLHLIATAYQHCEE
CYP71D17 Prunus dulcis chloroplast (almond)
GenEMBL AF107765
Ma,R. and Oliveira,M.M.
A putative Prunus dulcis cytochrome P450 gene sequence
Unpublished
chloroplast gene encoding chloroplast protein, partial cds.
70% identical to 71D sequences these sequences may be chloroplast P450s
MFVPRECREKCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPDSFNPDRFLDSSIDY
KGTNFEYIPFGAGRRMCPGMSFGLANVELPLALLLYHFDWKLPDG
CYP71D18 Mentha spicata (spearmint) Formerly CYP71D12
GenEMBL AF124815
Shari Lupien, Rodney Croteau
Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
(mentha) Species
unpublished
submitted to nomenclature committee 1/24/99
50% identical to 71D7, 69% identical to 71D13
(-)4S-Limonene-6-Hydroxylase
Note: due to a mistake on my part the name 71D12 was assigned
to two sequences. The sequence of Schroeder has priority
Since it was submitted and named earlier than Lupiens sequence.
CYP71D19 Capsicum annuum (pepper)
GenEMBL AF122821
Oh,B.J., Ko,M.K., Kim,Y.S., Kim,K.S., Kostenyuk,I. and Kee,H.K.
A cytochrome P450 gene is differentially expressed in compatible
and incompatible interactions between pepper (Capsicum annuum) and
the anthracnose fungus, Colletotrichum gloeosporioides
Mol. Plant Microbe Interact. 12 (12), 1044-1052 (1999)
58% to 71D6
CYP71D20 Nicotiana tabacum (tobacco)
GenEMBL AF368376
Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM,
Chappell J.
Cloning, heterologous expression, and functional characterization of
5-epi-aristolochene-1,3-dihydroxylase from tobacco
(Nicotiana tabacum).
Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
Submitted to nomenclature committee Sept. 22, 2000
81% to 71D4
gene 1
CYP71D21 Nicotiana tabacum (tobacco)
GenEMBL AF368377
Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM,
Chappell J.
Cloning, heterologous expression, and functional characterization of
5-epi-aristolochene-1,3-dihydroxylase from tobacco
(Nicotiana tabacum).
Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
Submitted to nomenclature committee Sept. 22, 2000
82% to 71D4
gene 2
71E Subfamily
CYP71E1 Sorghum bicolor
GenEMBL AF029858
Soren Bak, Rachel Alice Kahn, Hanne Linde Nielsen, Birger
Lindberg Moller, Barbara Ann Halkier
Cloning of three A-type cytochromes P450, CYP71E1,
CYP98, and CYP99 from Sorghum bicolor (L.) Moench by
a PCR approach and identification by expression in
Escherichia coli of CYP71E1 as a multifunctional
cytochrome P450 in the biosynthesis of the cyanogenic
glucoside dhurrin.
Plant Molecular Biology 36 (3):393-405, 1998.
CYP71E2 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
Submitted to nomenclature committee 3/29/2000
clone name 71g
58% identical to 71E1 37% to 71F1, 41% to 71G1 and G2
CYP71E3X Triticum aestivum (wheat) name changed to CYP71M3
No accession number
Daniele Werck-Reichhart
Submitted to nomenclature committee 6/4/2001
clone name 71-2
52% identical to 71E1 51% to 71E2, 43% to 71A11
46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
42% to 71G1v1, 40% to 71J, 38% to 71K
CYP71F1 Triticum aestivum (wheat)
No accession number
Hiromasa Imaishi
40-42% identical to 71D sequences 43% identical to 71A1
clone name N-1
submitted to nomenclature committee 1/8/2000
CYP71G1v1 Asparagus
No accession number
Hiromasa Imaishi
submitted to nomenclature committee 3/2/2000
clone name ASPI-1
49% to CYP71A1, 40% to 71A14, 45% to 71E1, 43% to 71B9,
37% to 71D13, 37% to 71C1, 39% to 71F1
CYP71G1v2 Asparagus
No accession number
Hiromasa Imaishi
submitted to nomenclature committee 3/2/2000
clone name ASPI-2
99% to CYP71G1v1 (4 amino acids differences)
CYP71H1X Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
55% to 71C4 but only 50% to 71C8, 58% to 71C7
clone name 71F8I2
submitted to nomenclature committee July 18, 2000
This sequence has been reassigned to the 71C subfamily
It is on the outskirts of the subfamily, but new sequences
force it to belong there rather than in a new subfamily.
CYP71J1 Asparagus
No accession number
Hiromasa Imaishi
submitted to nomenclature committee 12/5/2000
clone name ASPI-3
47% to CYP71A1, less to other 71 subfamilies
>CYP71K1 Oryza sativa (rice)
GenEMBL AP002968
46% to 71F1 40% to 71A11, 41% to 71G1v2
40% to 71C7, 40% to 71B24 42% to 71D4 38% to 71E1
MAELPLYLLLLALLVAVPFLCLTRWSLRHGGGGGGRLPPSPWAL
PVIGHLHHVAGALPHRAMRDLARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAF
ATRPITPTGKVLMADSVGVVFAPYGDGWRTLRRICTLELLSARRVRSFRAVREEEVGR
LLRAVAAAAAVAALTTPGATAAVNLSERISAYVADSAVRAVIGSRFKNRAAFLRMLER
RMKLLPAQCLPDLFPSSRAAMLVSRMPRRMKRERQEMMDFIDDIFQEHHESRAAAGAE
EDLLDVLLRIQSQDKTNPALTNDNIKTVIIDMFVASSETAATSLQWTMSELMRNPRVM
RKAQDEVRRALAIAGQDGVTEESLRDLPYLHLVIKESLRLHPPVTMLLPRECRETCRV
MGFDVPEGVMVLVNAWAIGRDPAHWDSPEEFAPERFEGVGAADFKGTDFEYIPFGAGR
RMCPGMAFGLANMELALAALLYHFDWELPGGMLPGELDMTEALGLTTRRCSDLLLVPA
LRVPLRDHER
CYP71L1 Hordeum vulgare (barley)
No accession number
Kirsten A Nielsen
Most like CYP71E about 50%
submitted to nomenclature committee 5/16/2002
526 amino acids
CYP71M1 Hordeum vulgare (barley)
No accession number
Kirsten A Nielsen
Most like CYP71E about 50%
submitted to nomenclature committee 5/16/2002
514 amino acids
only 42% to 71L1
CYP71M2 Sorghum bicolor
No accession number
Kirsten A Nielsen
70% to CYP71M1
submitted to nomenclature committee 8/2/2002
525 amino acids
CYP71M3 Triticum aestivum (wheat) formerly CYP71E3
No accession number
Daniele Werck-Reichhart
Submitted to nomenclature committee 6/4/2001
clone name 71-2
52% identical to 71E1 51% to 71E2, 43% to 71A11
46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
42% to 71G1v1, 40% to 71J, 38% to 71K, 43% to 71L1, 92% to 71M1
CYP71N1 Musa acuminata (banana)
GenEMBL AY062168
Lee,Y.C. and Pua,E.C.
Cloning and Characterization of Cytochrome P450 in Banana (Musa
acuminata)
Unpublished
50% to 71G1 less to other CYP71 subfamilies
more names exist here for the rice P450s that have not been added yet to the nomenclature pages
CYP71R4 Lolium rigidum (ryegrass)
No accession
Hiromasa Imaishi
Clone W1B11-HT
63% to rice AP003575 CYP71R2P
more rice subfamilies belong here, not inserted yet
CYP71AH1 tobacco
no accession number
Takashi Yamada
tobacco sequence 2
submitted to nomenclature committee 9/9/97
Formerly 71A11, renamed CYP71AH1 only 46% to 71B38
72A Subfamily
Note on the 72A subfamily. The 72A subfamily from different species appears to contain
multiple members. These sequences are very similar to each other, so they were not present in the common ancestor to the 72A group. They may represent alleles of the same gene or duplications of a single gene that have diverged slightly. I have tried to keep families with only one sequence per species with a single name as in CYP72A for all species. This approach breaks down when multiple alleles or highly similar duplications are present. The only practical solution is to assign different names to each species as in 72A1, 72A2, 72A3, etc. and use v1, v2, v3 for the highly similar variations in a single species. Variants had already been assigned to 72A from Catharanthus roseus, but since this was one of the first cases where v numbers were used, the first sequence was not given a v designation. The second sequence was called v1 and the third v2. The nomenclature has since been defined such that any new sequence is by default given the v1 designation. The v1 designation is not used unless other variants are known. The second sequence is then v2 etc. To correct this error, the first 72A1 sequence is being relabeled as 72A1v3, while the other two sequences remain the same. Other species are now assigned different numbers as 72A2 etc. with v numbers given as needed. It is still acceptable to refer to the 72A subfamily, but different species will now have separate numbers.
CYP72A1v1 Catharanthus roseus
GenEMBL L19074 (2646bp)
Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
Gene and cDNA for plant cytochrome P450 proteins (CYP72 family)
from Catharanthus roseus: and transgenic expression in tobacco and
Arabidopsis thaliana.
Plant Sci. 96, 129-136 (1994)
Note: sequence called CYP72B, 8 amino acid differences with
CYP72A1v3 (see second entry under 72A1v3 for function information)
CYP72A1v2 Catharanthus roseus
GenEMBL L19075 (1633bp)
Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
Gene and cDNA for plant cytochrome P450 proteins (CYP72 family)
from Catharanthus roseus: and transgenic expression in tobacco and
Arabidopsis thaliana.
Plant Sci. 96, 129-136 (1994)
Note: sequence called CYP72C, 14 amino acid differences with
CYP72A1v3 plus a 3 amino acid C-terminal extension.
(see second entry under 72A1v3 for function information)
CYP72A1v3 Catharanthus roseus L. (Madagascar periwinkle)
GenEMBL L10081 (1854bp) Swiss Q05047 (524 amino acids)
Vetter,H.-P., Mangold,U., Schroeder,G., Marner,F.-J.,
Werck-Reichhart,D. and Schroeder,J.
Molecular analysis and heterologous expression of
an inducible cytochrome P-450 protein from periwinkle
(Catharanthus roseus L.)
Plant Physiol. 100, 998-1007 (1992)
NEW Update on function of CYP72A1 encoded by (L10081):
Irmler, S., Schršder, G., St-Pierre, B., Crouch, N.P., Hotze, M.,
Schmidt, J., Strack, D., Matern, U. and Schršder, J. (2000) Indole
alkaloid biosynthesis in Catharanthus roseus: new enzyme activities
and identification of cytochrome P450 CYP72A1 as secologanin
synthase. Plant J. 24, 797-804.
CYP72A1v3 converts loganin into secologanin.
GenEMBL X69775 (365bp PCR fragment)
Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
Isolation of cytochrome P-450 cDNA clones from the higher plant
Catharanthus roseus by a PCR strategy.
Plant Molec. Biol. 22, 379-383 (1993)
Note: sequence 3 from Fig. 2. (identical to 72A1)
CYP72A1 Catharanthus roseus (Madagascar periwinkle) PCR fragment
GenEMBL X69789 (375bp)
Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
Isolation of cytochrome P-450 cDNA clones from the higher plant
Catharanthus roseus by a PCR strategy.
Plant Molec. Biol. 22, 379-383 (1993)
Note: sequence 1 from Fig. 2.
(see second entry under 72A1v3 for function information)
CYP72A1 Catharanthus roseus (Madagascar periwinkle) PCR fragment
GenEMBL X69790 (327bp)
Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
Isolation of cytochrome P-450 cDNA clones from the higher plant
Catharanthus roseus by a PCR strategy.
Plant Molec. Biol. 22, 379-383 (1993)
Note: sequence 2 from Fig. 2.
(see second entry under 72A1v3 for function information)
CYP72A2 Nicotiana plumbaginifolia
GenEMBL U35226(1787bp)
LaRosa P.C. and Smigocki, A.C.
A wound-inducible cytochrome P-450 in Nicotiana plumbaginifolia
unpublished (1996)
CYP72A3X Nicotiana tabacum (tobacco)
no accession number
Francis Durst
submitted to nomenclature committee
Francis Durst denies he ever sent a tobacco CYP72 sequence. This is
Probably an accident, since he did send three tobacco sequences and
a wheat CYP72 in one email. I probably thought they were all
tobacco and misnamed this one.
CYP72A4X Arabidopsis thaliana ESTs
GenEMBL T13009 (removed from Genbank, same as T04134), T04134 (72A11),
T22603 (72A13), H36956 (72A14), T44202 (72A13), R90024 (72A7)
N-terminal fragments, more than one sequence is present
GenEMBL T22449 (72A15), T45915 (72A15), H36129 (72A11)
middle fragments
GenEMBL Z46541 (72A14), Z46540 (72A14)
C-terminal fragments
note: the whole gene sequence can be assembled from these ESTs,
but it may be a chimera of several isoforms. There seem to be at
least 3 different N-terminals.
Note: There is a cluster of 8 CYP72A genes and one pseudogene on
AB023038. Therefore, this chimeric sequence has been retired.
CYP72A5 Zea mays
no accession number (318 amino acids)
Mike Persans and Mary Schuler
submitted to nomenclature committee
PCR4
formerly CYP95A1 (missnamed due to a frame shift in the PCR fragment)
ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)
CYP72A5 Zea mays (maize)
no accession number
Mike Barrett
clone A8 most like PCR fragment PCR4 from Mike Persans and Mary Schuler
The PCR4 fragment was missnamed as CYP95A1 due to a frame shift error in
the sequence in the I-helix region.
also like Arabidopsis GSS BAC end fragment B24203 (67% identical)
submitted to nomenclature committee 5/15/98
ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)
146 LLANGLVNHDGEKWAKHRRILNPAFHHEKIKGMMPVFSTCCIEMITRWDNSMPSEGSSEI
DVWPEFQNLTGDVISRTAFGSNYQEGRRIFELQGELAERLIQSVQTIFIPGYWFLPTKNN
RRMRAIDVEIRKILREIIGKREKDTKNRETNNDDLLGLLLESNTRQSNGNASLGLTTXDV
IEECKLFYFAGMET 339
441 ASEFNPERFANGISXATRHQAAFFPFGGGPRICIGQSFALLEAKMTLCTILQRFSFELSP
SXTHAPYXVITLHP 514
CYP72A6v1 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
clone name CYP72A 47% identical to C. roseus CYP72A1
CYP72A6v2 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
clone name CYP72B
This sequence is 100% identical to the other 72A6v2 sequence
from amino acid 130 to the end. The N-terminal 129 amino acids match
no sequences in Genbank. I suspect this is a chimeric clone.
CYP72A6v2 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
clone name CYP72B' 96% identical to CYP72A6v3 95% identical to
CYP72A6v1
CYP72A6v3 Triticum aestivum (wheat)
no accession number
Daniele Werck
submitted to nomenclature committee 1/20/99
clone name CYP72C 96% identical to CYP72A6v2 95% identical to CYP72A6v1
CYP72A7 Arabidopsis thaliana
GenEMBL AB023038 40540-42460
ESTs R90024 (2/26/99)
CYP72A8 Arabidopsis thaliana
GenEMBL AB023038 42944-44810
no ESTs (2/26/99)
CYP72A9 Arabidopsis thaliana
GenEMBL AB023038 45458-47366
no ESTs (3/1/99)
CYP72A10 Arabidopsis thaliana
GenEMBL AB023038 47816-49744
no ESTs (3/1/99)
CYP72A11 Arabidopsis thaliana
GenEMBL AB023038 50166-52122
ESTs H36129, T04134 (3/1/99)
CYP72A12P Arabidopsis thaliana
GenEMBL AB023038 52192-52485 lone exon 5
GSS fragment B24203 97% identical
no ESTs (3/1/99)
CYP72A13 Arabidopsis thaliana
GenEMBL AB023038 52920-54868
ESTs T44202, N96036, N96740 (3/1/99)
CYP72A14 Arabidopsis thaliana
GenEMBL AB023038 62438-64419
ESTs H36956, Z46541, Z46540 (3/1/99)
CYP72A15 Arabidopsis thaliana
GenEMBL AB023038 65370-67267
ESTs T45915, T22449 (3/1/99)
CYP72A16 Zea mays
No accession number
Jian Wang and Mary Schuler
80% to 72A5 EST AI857222
submitted to nomenclature committee 12/1/99
CYP72A17 Oryza sativa (rice)
GenEMBL AP002839.1 36553-39431
Go to sequences
CYP72A18 Oryza sativa (rice)
GenEMBL AP002839.1 44993-41630
Hiromasa Imaishi
Submitted to nomenclature committee 8/18/2000
Go to sequences
CYP72A19 Oryza sativa (rice)
GenEMBL AP002839.1 comp(53699-51708)
Go to sequences
CYP72A20 Oryza sativa (rice)
GenEMBL AP002839.1 56581-59004
Go to sequences
CYP72A21 Oryza sativa (rice)
GenEMBL AP002839.1 61993-63890
Hiromasa Imaishi
Submitted to nomenclature committee 3/2/2000
Clone name CL-8904
53% identical to 72A15
Go to sequences
CYP72A22 Oryza sativa (rice)
GenEMBL AP002839.1 66435-68424
Go to sequences
CYP72A23 Oryza sativa (rice)
GenEMBL AP002839.1 72149-74091
Go to sequences
CYP72A24 Oryza sativa (rice)
GenEMBL AP002839.1 109970-113787
Go to sequences
CYP72A25 Oryza sativa (rice)
GenEMBL AP002839.1 115472-117492
Go to sequences
CYP72A26 Zea mays (maize)
No accession number
Mary Schuler and Jian Wang
Submitted to nomenclature committee Oct. 2, 2000
Clone name 12/7B
62% to 72A5
CYP72A27 Zea mays (maize)
No accession number
Mary Schuler and Jian Wang
Submitted to nomenclature committee Oct. 23, 2000
Clone name 11G
95% identical to 72A26, but matches three ESTs at points of difference
CYP72A28 Zea mays (maize)
No accession number
Mary Schuler and Jian Wang
Submitted to nomenclature committee Oct. 23, 2000
Clone name E5D
66% to CYP72A26
CYP72A29 Solanum tuberosum L. May Queen
No accession number
Hisaharu Kato
Submitted to nomenclature committee 1/15/2002
84% to 72A2
CYP72A30 Lycopersicon esculentum (tomato)
GenEMBL AF249329
Bartoszewski,G., Mujer,C.V., Niemirowicz-Szczytt,K. and
Smigocki,A.C.
Tomato (Lycopersicon esculentum) cDNA sequence encoding a
protein similar to a cytochrome P450 enzyme
Unpublished
74% to 72A29
note small gap compared to other 72As, may be missing some
coding sequence
72B Subfamily
CYP72B1 Arabidopsis thaliana ESTs
GenEMBL AC003105
42% identical to C. roseus 72A1
ESTs T04442
CYP72B2X Arabidopsis thaliana ESTs
GenEMBL B96503 (661bp)
F23A22TF
C-terminal PERF region to end
This sequence is actually part of CYP714A1
CYP72C1 Arabidopsis thaliana
GenEMBL AC007651 88180-91153
45% identical to 72A9
73A Subfamily
CYP73A1 Helianthus tuberosus (Jerusalem artichoke) cinnamate 4-hydroxylase
GenEMBL Z17369 (1620bp) Swiss Q04468 (505 amino acids)
PIR S28495 A47454 (505 amino acids)
Teutsch,H.G., Hasenfratz,M.P., Lesot,A., Stoltz,C., Garnier,J.-M.,
Jeltsch,J.-M., Durst,F. and Werck-Reichhart,D.
Isolation and sequence of a cDNA encoding the Jerusalem
artichoke cinnamate 4-hydroxylase, a major plant cytochrome P450
involved in the general phenylpropanoid pathway.
Proc. Natl. Acad. Sci. USA 90, 4102-4106 (1993)
CYP73A2 Phaseolus aureus (mung bean) PIR listing has Vigna radiata (mung bean)
GenEMBL L07634 (1766bp) PIR JC1458 (501 amino acids)
PIR PC1238 (74 amino acids)
Mizutani,M., Ward,E.R., DiMaio,J., Ryals,J.A., Ohta,D.
and Sato,R.
Molecular cloning and sequencing of a cDNA encoding
mung bean cytochrome P450 (P450C4H) possessing cinnamate
4-hydroxylase activity.
Biochem. Biophys. Res. Commun. 190, 875-880 (1993)
CYP73A3 Medicago sativa (alfalfa) cinnamate 4-hydroxylase
GenEMBL L11046 (1744bp) PIR S36878 (506 amino acids)
Fahrendorf,T. and Dixon,R.A.
Molecular cloning of the elicitor-inducible cinnamic acid
4-hydroxylase cytochrome P450 from alfalfa.
Arch. Biochem. Biophys. 305, 509-515 (1993)
CYP73A4 Catharanthus roseus (Madagascar periwinkle) PCR fragment
GenEMBL X69788 (321bp)
Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
Isolation of cytochrome P-450 cDNA clones from the higher plant
Catharanthus roseus by a PCR strategy.
Plant Molec. Biol. 22, 379-383 (1993)
Note: sequence 16 from Fig. 2.
CYP73A4 Catharanthus roseus (Madagascar periwinkle)
GenEMBL Z32563 (1713 bp)
Hotze,M., Schroeder, G. and Schroeder,J.:
Cinnamate 4-hydroxylase from Catharanthus roseus,
and a strategy for the functional expression of
plant cytochrome P450 proteins as translational
fusions with P450 reductase in Escherichia coli.
FEBS Letters 374, 345-350 (1995)
CYP73A5 Arabidopsis thaliana
GenEMBL U71080 (5432bp) U71081 (1727bp)
Bell-Lelong, D.A., Cusamano, J.C., Meyer, K. and Chapple, C.C.
Cinnamate-4-hydroxylase expression in Arabidopsis. Regulation
in response to development and the environment.
Plant Physiol. 113, 729-738 (1997)
CYP73A5 Arabidopsis thaliana
GenEMBL U93215
T06B20.16
CYP73A5 Arabidopsis thaliana
GenEMBL U37235
Mignotte-Vieux,C., Kazmaier,M., Urban,P. and Pompon,D.
unpublished (1999)
CYP73A5 Arabidopsis thaliana
GenEMBL D78596 (1711bp, 505 amino acids) also D78597 partial seq.
Mizutani,M., Ohta,D. and Sato,R.
Isolation of a cDNA and a genomic clone encoding cinnamate
4-hydroxylase from Arabidopsis and its expression manner in planta
Plant Physiol. 113, 755-763 (1997)
P450C4H
CYP73A5 Arabidopsis thaliana EST
GenEMBL T04086 (480bp) F19837
C-terminal fragment
CYP73A6 Zea mays
Sharon Potter
sequence e
submitted to nomenclature committee 6/8/94
CYP73A7 Zea mays
Sharon Potter
sequence c
submitted to nomenclature committee 6/8/94
ESTs AI666136 AW519858.1 BG320001.1 BE639176.1
php20835.x3.b an STS from the CSHL STS Maize Database
http://nucleus.cshl.org/maizegenome/
currently missing 67 aa at N-terminal
IFL LRMGVRNLVV VSTPELAKEV LHTQGVEFGS
RTRNVVFDIF TGKGQDMVFT VYGDHWRKMR RIMTVPFFTN KVVAQNRAGW
EEEARLVVED VRKDPEAAAG GVVLRRRLQL MMYNDMFRIM FDRRFDSEHD
PLFNKLKALN AERSRLSQSF EYNYGDFIPV LRPFLRGYLN RCHDLKTRRM
KVFEDNFVQE RKXXMAQTGE IRCAMDHILE AERKGEINHD NVLYIVENIN
VAAIETTLWS IEWGIAELVN HPAIQHKLRE ELASVLGAGV PVTEPDLERL
PYLQAIVKET LRLRMAIPLL VPHMNLNDGK LAGYDIPAES KILVNAWFLA
NDPKRWVRPD EFRPERFLEE EKSVEAHGND FRFVPFGVGR RSCPGIILAL
PIIGITLGRL VQNFQLLPPP GLDKIDTTEK PGQFSNQIAK HATIVCKPLE
A*
CYP73A8 Zea mays
Sharon Potter
sequence f
submitted to nomenclature committee 6/8/94
CYP73A9 Pisum sativum (pea)
GenEMBL U29243 (1715bp)
Frank,M.R., Deyneka,J.M. and Schuler,M.A.
Cloning of phenylpropanoid pathway P450 monooxygenases expressed in
Pisum sativum.
unpublished
CYP73A10 Petroselinum crispum (parsley)
GenEMBL L38898 (1801bp)
Logemann,E., Parniske,M. and Hahlbrock,K.
Modes of expression and common structural features of the complete
phenylalanine ammonia-lyase gene family in parsley
Proc. Natl. Acad. Sci. U.S.A. 92, 5905-5909 (1995)
sequence sent by Edda Koopmann
CYP73A11 Glycine max (soybean)
GenEMBL X92437 (1787bp)
Schopfer,C.R. and Ebel,J.
Identification of elicitor-induced cytochrome P450s of soybean
(Glycine max L.) using differential display of mRNA
Mol. Gen. Genet. 258, 315-322 (1998)
CYP73A12 Zinnia elegans
GenEMBL U19922 (1648bp)
Ye, E. and Varner, J.E.
Expression patterns of cinnamic acid 4-hydroxylase gene during lignification
in Zinnia.
unpublished
CYP73A13 Populus tremuloides (quaking aspen)
GenEMBL U47293 (1803bp)
Ge,L. and Chiang,V.L.
A full length cDNA encoding trans-cinnamate 4-hydroxylase from developing
xylem of Populus tremuloides
Plant Physiol. 112, 861 (1996)
CYP73A14 Glycyrrhiza echinata (licorice)
GenEMBL D87520
Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells
and their transcriptional activation by elicitor treatment.
Plant Science 126, 39-47 (1997)
CYP73A14v1 Glycyrrhiza echinata (licorice)
GenEMBL D89430
Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells
and their transcriptional activation by elicitor treatment.
Plant Science 126, 39-47 (1997)
C-terminal PCR fragment with 4/82 amino acid differences to 73A14
CYP73A15 Phaseolus vulgaris (french bean)
Y09447 (1799bp) Y09448 (2280bp) Y09449 (1065bp)
Jupe,S.C., Werck-Reichhart,D. and Bolwell,G.P.
Molecular cloning of a novel CYP73 from French bean: induction by
elicitor and during xylogenesis.
Unpublished
CYP73A16 Populus kitakamiensis (hybrid aspen)
GenEMBL D82815(1737bp) mRNA
GenEMBL D82814(2923bp) partial gene sequence
GenEMBL D82812, D82813, D82814 closely related genes
Kawai S, Mori A, Shiokawa T, Kajita S, Katayama Y, Morohoshi N.
Isolation and analysis of cinnamic acid 4-hydroxylase homologous genes from a
hybrid aspen, Populus kitakamiensis.
Biosci Biotech Biochem. 60, 1586-97
CYP73A17 Triticum aestivum (wheat)
no accession number
Francis Durst
submitted to nomenclature committee
CYP73A17 Triticum aestivum (wheat)
GenEMBL AF123608
Batard,Y., Hehn,A., Nedelkina,S., Schalk,M., Pallett,K.,
Schaller,H. and Werck-Reichhart,D.
Increasing expression of P450 and P450-reductase proteins from
monocots in heterologous systems
Arch. Biochem. Biophys. 379 (1), 161-169 (2000)
CYP73A18 L. esculentum (tomato)
GenEMBL Z70216 PCR fragment (202bp)
this sequence differs from 73A24, but this might be due to errors
there are no other ESTs that match this PCR fragment.
CYP73A19 Cicer arietinum (chickpea)
GenEMBL AJ007449
Overkamp, S. and W. Barz, W. Isolation of a Full Length cDNA Encoding
Trans-Cinnamate 4-Hydroxylase (Accession No. AJ007449) from Chickpea (Cicer
arietinum L.). (PGR99-086) Plant Physiol. 120, 635 (1999)
91% identical to Medicago sativa CYP73A3
CYP73A20 Pinus taeda (loblolly pine)
GenEMBL AF096998
Anterola,A.M., Jeon,J.H., Davin,L.B. and Lewis,N.G.
Pinus taeda mRNA for trans-cinnamate 4-hydroxylase (PTC4H) is
induced in cell suspension cultures by 8% sucrose/20mM KI treatment
Unpublished
CYP73A21 Capsicum chinense (habanero chile)
GenEMBL AF088847
Curry,J. and O'Connell,M.A.
Cinnamic acid 4-hydroxylase from habanero chile
Unpublished
CYP73A22 Mesembryanthemum crystallinum
GenEMBL AF097664
Michalowski,C.B. and Bohnert,H.J.
cinnamate 4-hydroxylase mRNA from the common ice plant
Unpublished
CYP73A23 Pinus taeda
GenEMBL AI812813, AA556941, AI812771, AI812842, AI919827
sequence made from ESTs only
missing 160 amino acids at N-terminal
81% to 73A20 and many other 73A sequences
CYP73A24 tomato
GenEMBL ESTs only
AI484139 EST248946 cLER1C5
AI894646 EST264089 cLEC4L12
AI490789 EST241497 cLEB3H9
AI774477 EST255577 cLER12O4
AI895653 EST265096 cLEC9O20
AI484136 EST248943 cLER1C5
AI899232 EST268675 cLED37P6
AI490786 EST241494 cLEB3H9
AI774140 EST255240 cLER10B24
AI773934 EST255034 cLER8N1
AI487946 EST246268 cLED19L20
AI484879 EST243140 cLED3A21
AI894393 EST263848 cLEC4G23
AI895830 EST265273 cLEC10A6
AI895463 EST264906 cLEC7J20
MDLLLLEKTLIGLFFAILIAIIISKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE
YAKKFGDVFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVF
TVYGEHWRKMRRIMTVPFFTNKVVQQYRGGWESEAASVVEDVKKN
PESATNGIVLRKRLQLMMYNNMFRIMFDRRFESEDDPLFVKLKALNGERS
RLAQSFEYNYGDFIPILRPFLRGYLKICKEVKEKRLKLFKDYFVDERKKL
ANTKSMDSNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEW
GIAELVNHPHIQKKLRDEIDTVLGPGVQVSEPDMPKLPYLQAVIKETLRL
RMAIPLLVPHMNLHDAKLAAYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVE
ANGNDFRFLPFGVGSRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKLDTSEKGGQFSL
HILKHSTIVMKPRSF*
CYP73A25 Gossypium arboreum (cotton)
GenEMBL AF286647
Xiao-Ya Chen and Ping Luo
Clone name LP89
92% to 73A16
CYP73A26 Gossypium arboreum (cotton)
GenEMBL AF286648
Xiao-Ya Chen and Ping Luo
Clone name LP125
91% to 73A25
CYP73A27 Nicotiana tabacum (tobacco)
GenEMBL AF368378
Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM,
Chappell J.
Cloning, heterologous expression, and functional characterization of
5-epi-aristolochene-1,3-dihydroxylase from tobacco
(Nicotiana tabacum).
Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
Submitted to nomenclature committee Oct. 10, 2000
67% to 73A22, 71% to 73A15, 72% to 73A29
clone name cDNA 1
CYP73A28 Nicotiana tabacum (tobacco)
GenEMBL AF368379
Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM,
Chappell J.
Cloning, heterologous expression, and functional characterization of
5-epi-aristolochene-1,3-dihydroxylase from tobacco
(Nicotiana tabacum).
Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
Submitted to nomenclature committee Oct. 10, 2000
95% to 73A27
clone name cDNA 2
CYP73A29 Citrus sinensis
GenEMBL AF255013.1
Betz,C., McCollum,T.G. and Mayer,R.T.
Differential expression of two cinnamate 4-hydroxylase genes in
Citrus
Unpublished
cinnamate 4-hydroxylase (C4H1)
72% to 73A27
CYP73A30 Lithospermum erythrorhizon (a Japanese medicinal plant)
No accession number
Hajime Mizukami
Submitted to nomenclature committee Oct. 25, 2000
Clone name LEC4H1 83% to 73A4, 91% identical to 73A31
CYP73A31 Lithospermum erythrorhizon (a Japanese medicinal plant)
No accession number
Hajime Mizukami
Submitted to nomenclature committee Oct. 25, 2000
Clone name LEC4H2 91% identical to 73A30
CYP73A32 Ruta graveolens (common rue)
GenEMBL AJ309127
Antoine Gravot
Submitted to nomenclature committee 3/29/01
87% to cotton CYP73A25
CYP73A33 Sorghum bicolor
No accession number
Ron Coolbaugh
95% identical to 73A7, 90% to 73A17, 73% to 73A6, 61% to 73A8
CYP73A34 Hordeum vulgare (barley)
Assembled from overlapping ESTs
88% to 73A33, 87% to 73A7
BF620285.2 1-176 (no diffs) BE413007.1 49-282 (no diffs) BG367496 128-302 (no diffs)
AL504406.1 182-383 (no diffs) BE519761.2 245-401 (no diffs) BE412402.1 383-501 (no diffs)
MDVLLLEKALLGLFAAAVLAIAVAKLAGKRFRLP
PGPSGAPIVGNWLQVGDDLNHRNLMGLAKRFGEVFLLRMGVRNLVVVSSPELAKEVLHTQ
GVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVAQNRVGWEEEA
RLVVEDLRADPAAATKGVVVRRRLQLMMYNDMFRIMFDRRFETVADPLFNQLKALNA
ERSILSQSFDYNYGDF
IPVLRPFLRRYLNRCTNLKTKRMKVFEDHFVQQRKEALEKTGEIKCAMDHILEAERKGEI
NHDNVLYIVENINVAAIETTLWSIEWGLAELVNHPEIQQKLREEIVAVLGPGTPVTEPDL
ERLPYLQSVVKETLRLRMAIP
LLVPHMNLSDAKLAGYDIPAESKILVNAWFLANDPKRWVRADEFRPERFLEEERAVEANG
NDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQNFQLLPPLGKDKIDTTEKPGQFSNQI
RNHATVVCKPLKA*
CYP73A35P Oryza sativa (rice)
GenEMBL AP003446.1 March 29, 2001
AP003302.1 Feb. 21, 2001
Both sequences have the same frameshifts so
This is probably a pseudogene
MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAA
LARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 (25 nuc. deletion and frameshift in both sequences)
175 RRRLQLMMYSNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF
LRGYLRICEEVKETRLKLFKDFFLEERK (1)
KLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVA (1)
AIETTLWSMEWAIAEL (2 nuc. insertion and frameshift in both seqs.)
VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNLRD
AELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNVEANGNDFRYLPSGA
GRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF*
CYP73A36 Citrus sinensis
GenEMBL AF255014.2
Betz,C., McCollum,T.G. and Mayer,R.T.
Differential expression of two cinnamate 4-hydroxylase
genes in Citrus
Unpublished
88% to 73A1
CYP73A37 Citrus paradisi (Marsh Grapefruit)
GenEMBL AF378333.1
Legrum,W., McCollum,T.G., Doostdar,H., Shatters,R. and Mayer,R.T.
Cinnamate 4-hydroxylase in Marsh grapefruit flavedo
Unpublished
This sequence is 100% identical to 73A36 from aa 35 ITV to the end
The N-terminal of 73A36 is conserved on other 73As but the 73A37 N-
terminal is not conserved. I suspect it is not processed correctly
This may be the same gene as 73A36
CYP73A35P rice
aaaa01004255.1 $PI (indica ) ortholog of 73A35P
CYP73A38 rice
aaaa01002376.1 $FI (indica ) ortholog to AQ256364.1
CYP73A39 rice
aaaa01006093.1a $FI CYP73 (indica ) 99% to AP004850.1b
CYP73A40 rice
aaaa01006093.1b $FI CYP73 (indica ) 99% to AP004850.1a
98% to AAAA01006093.1a 73A39
CYP73A41 Ammi majus L. , Apiaceae (Bishops weed)
GenEMBL
Silvia Huebner
Submitted Jan 7, 2003
Only 8 amino acid differences to CYP73A10 from Petroselinum crispum
(parsley)
CYP73 Phaseolus vulgaris (kidney bean)
PIR S34739 (23 amino acids)
Rodgers, M.W., Zimmerlin, A., Werck-Reichhart, D. and Bolwell, G.P.
Microsomally associated heme proteins from French bean:
characterization of the cytochrome P450
cinnamate-4-hydroxylase and two peroxidases.
Arch. Biochem. Biophys. 304, 74-80 (1993)
74A Subfamily
Note on nomenclature of 74A sequences. Historically, each species has had only one 74A gene described.
This was true up until 2000 when the tomato and Hordeum vulgare both had two 74A genes. For simplicity in the
Nomenclature, 74A sequences were not numbered sequentially, but they were just named 74A. With the discovery of
multiple 74As in tomato and Hordeum it became necessary to assign numbers to the sequences. Once more, to keep the
nomenclature simple, all sequences from species with only one 74A are named CYP74A1. Those sequences that are from
species with two 74As have a number assigned to distinguish them from 74A1.
CYP74A1 Linum usitatissimum (flaxseed)
GenEMBL U00428 (2038bp)
Song,W.-C., Funk,C.D. and Brash,A,R.
Molecular cloning of an allene oxide synthase: A cytochrome
P450 specialized for the metabolism of fatty acid hydroperoxides.
Proc. Natl. Acad. Sci. USA 90, 8519-8523 (1993)
Note: This sequence has two exceptions to the P450 motif.
CYP74A1 Parthenium argentatum (guayule, a desert shrub)
GenEMBL X78166 (1674bp)
Pan,Z., Durst,F., Werck-Reichhart,D., Gardner,H.W., Camara,B.,
Cornish,K. and Backhaus,R.A.
The major protein of guayule rubber particles is a cytochrome
P450: Characterization based on cDNA cloning and spectroscopic
analysis of the solubilized enzyme and its reaction products
J. Biol. Chem. 270, 8487-8494 (1995)
CYP74A1 Arabidopsis thaliana
GenEMBL X92510 (1799bp)
Laudert D., Pfannschmidt, U., Lottspeich, F., Hollanderczytko, H., and
Weiler, E.W.
Cloning, molecular and functional characterization of Arabidopsis thaliana allene
oxide synthase (CYP-74), the first enzyme of the octadecanoid pathway to
jasmonates.
J. Mol. Biol. 31, 323-335 (1996)
Note: The EST N65720 matches this sequence closely, but not completely.
CYP74A1 Arabidopsis thaliana
GenEMBL AB007647
CYP74A1 Arabidopsis thaliana
GenEMBL Y12636
Kubigsteltig,I.I., Laudert,D. and Weiler,E.W.
Structure and regulation of the Arabidopsis thaliana allene oxide
synthase gene
Unpublished
CYP74A1 Arabidopsis thaliana
GenEMBL AF172727
Staswick,P.E.
Sequence of an Allene Oxide Synthase cDNA from Arabidopsis thaliana
(Accession No. AF172727). (PGR99-130)
Plant Physiol. 121 (1), 312 (1999)
CYP74A1 Arabidopsis thaliana
GenEMBL N65720(426bp)
middle region starting about 234 amino acids in.
CYP74A1 Lycopersicon esculentum (tomato)
GenEMBL AJ271093
Sivasankar,S., Sheldrick,B. and Rothstein,S.J.
Expression of allene oxide synthase determines defense-gene
activation in tomato
Unpublished
64% to Arabidopsis 74A1, 70% to tomato 74A2
CYP74A1 Hordeum vulgare
GenEMBL AJ250864
Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
tissue specific regulation in seedling development
Plant J. 21 (2), 199-213 (2000)
53% to Arabidopsis AOS, 89% to Hordeum 74A3
>CYP74A1 Nicotiana attenuata
GenEMBL AJ295274 16-NOV-2001
mRNA for allene oxide synthase (aos gene).
CYP74A1P1 Lupinus luteus (yellow lupine)
GenEMBL Z49255 comp(1719-2132)
possible pseudogene of CYP74A
42% identical to 74A of guayule, nearly identical to 74AP2
CYP74A1P2 Lupinus luteus (yellow lupine)
GenEMBL Z49255 comp(4284-4697)
possible pseudogene of CYP74A
42% identical to 74A of guayule
BM74B
CYP74A2 Lycopersicon esculentum (tomato)
GenEMBL AF230371
Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
Cytochrome P450-dependent metabolism of oxylipins in tomato.
Cloning and expression of allene oxide synthase and fatty acid
hydroperoxide lyase
Plant Physiol. 123 (2), 711-724 (2000)
63% to Arabidopsis 74A1, 70% to tomato 74A1
CYP74A3 Hordeum vulgare
GenEMBL AJ250864
Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
tissue specific regulation in seedling development
Plant J. 21 (2), 199-213 (2000)
54% to Arabidopsis AOS, 89% to Hordeum 74A1
74B Subfamily
CYP74B1 Capsicum annuum (bell pepper)
GenEMBL U51674 (1647bp)
Matsui, K. Shibutani,M., Kajiwara,T. and Hase,T.
fatty acid hydroperoxide lyase
unpublished
CYP74B2 Arabidopsis thaliana
GenEMBL Z97339 full length EST T20864 (367bp)
Newman,T.
unpublished (1994)
N-terminal 121 amino acids, different from X92510 full length 74A sequence.
CYP74B2 Arabidopsis thaliana
GenEMBL AF087932
Bate,N.J., Sivasankar,S., Moxon,C., Riley,J.C.M., Thompson,J.E. and
Rothstein,S.J.
Molecular characterization of an arabidopsis gene encoding
hydroperoxide lyase, a cytochrome P-450 that is wound inducible
Plant Physiol. 117, 1393-1400 (1998)
CYP74B3v1 Lycopersicon esculentum (tomato)
GenEMBL AJ239065
Sheldrick,B.
Thesis (1999) University of Guelph, Dept. of Molecular Biology and
Genetics, Guelph, ON, Canada
58% to 74B2
IPIMNPAPLSTPAPVTLPVRSIPGSYGLPLVGPIADRLDYFWFQ
KPENFFTKRMEKHKSTVFRTNVPPCFPFFGSVNPNVVAVLDVKSFSHLFDMEIVEKAN
VLVGDFMPSVVYTGDMRVCAYLDTSEPKHAQIKNFSQDILKRGSKTWVPTLLKELDTM
FTTFEADLSKSNTASLLPALQKFLFNFFSLTILGADPSVSPEIANSGYIFLDSWLAIQ
LAPTVSIGVLQPLEEILVHSFAYPFFLVKGNYEKLVQFVKNEAKEVLSRAQTEFQLTE
QEAIHNLWFILGFNAFGGFSIFLPTLLGNLGDEKNADMQEKLRKEVRDKVGVNPENLS
FESVKEMELVQSFVYETLRLSPPVPSQYARARKDFKLSSHDSVYEIKKGELLRGYQPL
VMKDPKVFDEPEKFVLERFTKEKGKELLNYLFWSNGPQTGRPTESNKQCAAKDMVTLT
ASLIVAYIFQKYDSVSFSSGSLTSVKKAS
CYP74B3v2 Lycopersicon esculentum (tomato)
GenEMBL AF230372
Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
Cytochrome P450-dependent metabolism of oxylipins in tomato.
Cloning and expression of allene oxide synthase and fatty acid
hydroperoxide lyase
Plant Physiol. 123 (2), 711-724 (2000)
4 amino acid diffs with 74B3v1
CYP74B4v1 Medicago sativa (alfalfa)
GenEMBL AJ249245
Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
and Vliegenthart,J.F.G.
Cloning and expression of alfalfa hydroperoxide lyase genes
characterization of 13-hydroperoxide lyase isoenzymes with an
unusual presequence and a proposal for a reaction mechanism
63% identical to 74B2 61% to 74B1 and 74B3
submitted to the nomenclature committee 8/23/99
CYP74B4v2 Medicago sativa (alfalfa)
GenEMBL AJ249246
Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
and Vliegenthart,J.F.G.
Cloning and expression of alfalfa hydroperoxide lyase genes
characterization of 13-hydroperoxide lyase isoenzymes with an
unusual presequence and a proposal for a reaction mechanism
97.5% identical to v1
the three forms show different activities
submitted to the nomenclature committee 8/23/99
CYP74B4v3 Medicago sativa (alfalfa)
GenEMBL AJ249246
Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
and Vliegenthart,J.F.G.
Cloning and expression of alfalfa hydroperoxide lyase genes
characterization of 13-hydroperoxide lyase isoenzymes with an
unusual presequence and a proposal for a reaction mechanism
99% identical to v1
the three forms show different activities
submitted to the nomenclature committee 8/23/99
CYP74B5 Psidium guajava (guava)
No accession number
Tijet N, Waspi U, Gaskin DJ, Hunziker P, Muller BL, Vulfson EN,
Slusarenko A, Brash AR, Whitehead IM.
Purification, molecular cloning, and expression of the gene
encoding fatty acid 13-hydroperoxide
lyase from guava fruit (Psidium guajava).
Lipids. 2000 Jul;35(7):709-20.
69% identical to CYP74B3
submitted to nomenclature committee 4/14/00
CYP74B6P Cucumis sativus (cucumber)
GenEMBL AF229812
Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
Fatty acid hydroperoxide lyases in cucumber hypocotyls
Unpublished
74C Subfamily
CYP74C1 Cucumis sativus (cucumber)
GenEMBL AF229811
Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
Fatty acid hydroperoxide lyases in cucumber hypocotyls
Unpublished
CYP74C2 Cucumis melo (cantaloupe melon)
GenEMBL AF081955
Tijet N. et al (2001) Arch. Biochem. Biophys. 386, 281-289.
a hydroperoxide lyase with specificity for both 9- and
13-hydroperoxides of linoleic and linolenic acids
CYP74C3 Lycopersicon esculentum (tomato)
No accession number
Gregg Howe
Submitted to nomenclature committee May 16, 2001
57% to 74C1 58% to 74C2
clone name LeAOS3
CYP74C4 Lycopersicon esculentum (tomato)
No accession number
Gregg Howe
Submitted to nomenclature committee Nov. 28, 2001
61% to 74C2 60% to 74C1 58% to 74C3
CYP74D1 Lycopersicon esculentum (tomato)
GenEMBL AF317515
Itoh A, Howe GA (2001) Molecular cloning of a divinyl ether synthase.
Identification as a novel CYP74 cytochrome P450. J. Biol. Chem. 276: 3620-3627
Submitted to nomenclature committee Aug. 28, 2000
divinyl ether synthase (LeDES)
54% to 74C4 50% to 74C2
CYP74D2 Solanum tuberosum (potato)
GenEMBL AJ309541
Stumpe,M., Kandzia,R., Goebel,C., Rosahl,S. and Feussner,I.
A pathogen induced divinyl ether synthase (CYP74D)from potato
suspension cultures
Unpublished
divinyl ether synthase (LeDES)
96% identical to 74D1 51% to 74C2
75A Subfamily
CYP75A1 Petunia hybrida cv. Blue Star
GenEMBL X71130 (1326bp) PIR S32110 (425 amino acids)
Toguri,T., Azuma,M. and Ohtani, T.
The cloning and characterization of a cDNA encoding a cytochrome P450
from the flowers of Petunia hybrida.
Plant Sci. 94, 119-126 (1993)
CYP75A1 Petunia hybrida
GenEMBL Z22544 (1740bp) PIR S33515 and S38984 (508 amino acids)
Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D.,
Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and
Cornish,E.C.
Cloning and expression of cytochrome P450 genes controlling flower
colour
Nature 366, 276-279 (1993)
CYP75A1 Petunia hybrida
GenEMBL D14588 (1846bp)
Ohbayashi,M., Shimada,Y. Nakano,R., Kiyokawa,S. and
Kikuchi,Y.
unpublished (1994)
flavanoid 3, 5' hydroxylase
CYP75A2 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X70824 (1696bp) Swiss P37120 (513 amino acids)
PIR S43342 (513 amino acids)
Toguri,T., Umemoto,N., Kobayashi,O. and Ohtani,T.
Activation of anthocyanin synthesis genes by white light in eggplant
hypocotyl tissues, and identification of an inducible P-450 cDNA.
Plant Molec. Biol. 23, 933-946 (1993)
CYP75A3 Petunia hybrida
GenEMBL Z22545 (1923bp) PIR S33521 and S38985 (506 amino acids)
Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D.,
Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and
Cornish,E.C.
Cloning and expression of cytochrome P450 genes controlling flower
colour
Nature 366, 276-279 (1993)
CYP75A4 Gentiana triflora
GenEMBL D85184 (1666bp)
Tonaka,Y. Yonekura,K., Fukuchi-Mizutani,M., Fukui,Y. Fujiwara,H.
Ashikari,T. and Kusumi,T.
Molecular and biochemical characterization of three anthocyanin synthetic
enzymes from Gentiana triflora
Plant Cell Physiol. 37, 711-716 (1996)
CYP75A5 Eustoma grandiflorum (lisianthus)
GenEMBL U72654 (2124bp)
Nielsen, K.M. and Podivinsky,E.
cDNA cloning and expression of a flavinoid 3'5' hydroxylase from petals
of Lisianthus (Eustoma grandiflorum Grise)
unpublished (1996)
CYP75A6 Campanula medium
GenEMBL D14590 (1927bp)
Ohbayashi,M.
CYP75A7 Eustoma russellianum
GenEMBL D14589 (2174bp)
Ohbayashi,M.
CYP75A8 Catharanthus roseus (Madagascar periwinkle)
GenEMBL AJ011862 (1595bp)
Kaltenbach,M., Schroeder,G., Schmelzer,E. Lutz,V. and Schroeder,J.
Flavonoid hydroxylase from Catharanthus roseus: cDNA, heterologous
expression, enzyme properties and cell type specific expression
in plants.
Plant J. 19, 183-193 (1999)
CYP75A9 Lycianthes rantonnei
GenEMBL AF313490
Eder,C.M. and Forkmann,G.
Lycianthes rantonnetii flavonoid 3',5'-hydroxylase
Unpublished
86% identical to 75A2
CYP75A10 Torrenia hybrida (cultivar:Summerwave Blue)
GenEMBL AB012925
Suzuki,K., Xue,H., Tanaka,Y., Fukui,Y., Fukuchi-Mizutani,M.,
Murakami,Y., Katsumoto,Y., Tsuda,S. and Kusumi,T.
Flower color modifications of Torenia hybrida by cosuppression of
anthocyanin biosynthesis genes
Mol. Breed. 6, 239-246 (2000)
73% to CYP75A8
CYP75B1 Arabidopsis thaliana
GenEMBL AL133421 and AB005249 at end of cosmid
GenEMBL AF241643 exon 1, AF241644 exon 2, AF241645 exon 3, AF241646 exon 4,
GenEMBL AF241647 exon 1 mutant
CYP75B2 Petunia hybrida
GenEMBL AF155332
Brugliera, F., Barri-Rewell, G., Holton, T.A. and Mason, J.G.
Isolation and Characterization of a flavonoid 3'-hydroxylase cDNA clone
corresponding to the Ht1 locus of Petunia hybrida.
The Plant Journal, 19, 441-451 1999
Florigene Ltd.
clone OGR-38 (67% identical to 75B1 N-terminal exon)
submitted to nomenclature committee 6/9/98
CYP75B3 Oryza sativa (rice)
GenEMBl AC021892
chromosome 10 clone 53D03
seq about 60% to 75B1 Missing part of N-term
61678 MDVVPLPLLLGSLAVSAAVWYLVYFLRGGTGANAARKRRPLPPGPRGXXXXGNL
PQLGXXXXXXXXXXXXXYGPLFRLRF 61442
XXXXXXXXXX
122805 APLAPSFLRGHDANF 122850 frame shift
122852 ATGPPNSGAEH
122885 VAYNYQDLVFAPTVALARLRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQQAA 123055
123056 SVALGQEANVCATNTLARATIGHRVFAVDGGEGAREFKEMVVELMQLAGVFNVGDFVPA 123232
123233 LRWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQPDGVAAGEHGNDLLSVLL 123394
123395 ARMQEEQKLDGDGEKITETDIKALLLNLF 123574
123575 TAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVGRGRLVSESDLPRLPYLTAVIKET 123754
123755 FRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIARDPTQWPDPLQYQPSRFLPG 123934
123935 RMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTATLVHGFDWTLANGATPDKLN 124114
124115 MEEAYGLTLQRAVPLMVQPVPRLLPSAYGV 124204
CYP75B4 Perilla frutescens var. crispa (Lamiaceae) (an Asiatic mint that produces oil seeds, Red Perilla,
beefsteak plant, chinese basil, purple mint)
GenEMBL AB045593
C. Kitada, M. Yamazaki, Y. Tanaka and K. Saito
69% to 75B2
Flavonoid 3'-hydroxylase
clone name SHT12
CYP75B5 Callistephus chinensis
GenEMBL AF313489
Eder,C.M. and Forkmann,G.
Callistephus chinensis flavonoid 3',5'-hydroxylase
Unpublished
66% identical to CYP75B2
CYP75B6 Callistephus chinensis
GenEMBL AF313488
Eder,C.M. and Forkmann,G.
Callistephus chinensis putative flavonoid 3'-hydroxylase
Unpublished
73% identical to CYP75B5
CYP75B7 Matthiola incana
GenEMBL AF313491
Eder,C.M. and Forkmann,G.
Matthiola incana flavonoid 3'-hydroxylase
Unpublished
63% identical to 75B5
CYP75B8 Pelargonium x hortorum
GenEMBL AF315465
Eder,C.M. and Forkmann,G.
Sequence of flavonoid 3'-hydroxylase
Unpublished
64% identical to 75B5
CYP75B9 Gentiana triflora (gentian)
No accession number
Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
flavonoid 3'-hydroxylase (F3'H)
submitted to nomenclature committee March 21, 2001
71% identical to CYP75B2
CYP75B10 Torenia hybrida (torenia hybrid)
No accession number
Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
flavonoid 3'-hydroxylase (F3'H)
submitted to nomenclature committee March 21, 2001
67% identical to CYP75B2
76A Subfamily
CYP76A1 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X71658 (1571bp) Swiss P37121 (467 amino acids)
PIR S38535 (467 amino acids)
Toguri,T., Kobayashi,O. and Umemoto,N.
The cloning of eggplant seedling cDNAs encoding proteins from a
novel cytochrome P450 family (CYP76)
Biochim. Biophys Acta 1216, 165-169 (1993)
Note: clone name F94 also called CYPEG8
CYP76A2 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X71657 (1827bp) Swiss P37122 (505 amino acids)
PIR S38534 (505 amino acids)
Toguri,T., Kobayashi,O. and Umemoto,N.
The cloning of eggplant seedling cDNAs encoding proteins from a
novel cytochrome P450 family (CYP76)
Biochim. Biophys Acta 1216, 165-169 (1993)
Note: clone name G17 also called CYPEG7.
CYP76A3 Petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 6/22/98
clone IMT-4 64% identical to 76A2
CYP76A4 Petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 6/22/98
clone IMT-6 63% identical to 76A1 and 76A3
CYP76A5 Petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 1/5/99
clone IMT-9 66% identical to 76A1 and 76A2
CYP76A6 tomato
GenEMBL ESTs only
AI779370 EST260249 cLES7J14
AI779369 EST260248 cLES7J14
AI488667 EST247006 cLED18N24
AI895030 EST264473 cLEC6H17
AI771692 EST252792 cLED34O18
AI774262 EST255457 cLER12I1 5 prime end = ARG10 homolog on reverse strand
AI779703 EST260582 cLES8J16
AI895857 EST265300 cLEC10E22
AI777873 EST258752 cLES3C24
AI777872 EST258751 cLES3C24
85% identical to 76A2
MEWELSYLFFSSIILLSIFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMA
ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPA
LARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRFVFLASFNMLG
NLILSKDLADPESEEASEFFHAMKGIMEWSGVANVSDVFPFLRKFDLQSLRKKMTRDMGK
AMEIMSMLLKERKKGMEKMKDFLDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTS
SSVEWALTELLRHPQAMAEVKTEISKAVGSNNKFEESDIENLPYMQAVIKESLRLHPPL
PFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPERFLGSKLDVKG
QHYELIPFGARRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSPKSINMDESMGVTA
RKRDSLKVIPKKV*
CYP76A7 Catharanthus roseus (Madagascar periwinkle)
No accession number
Joachim Schroeder
54% identical to 76A4 and 76A5
submitted to nomenclature committee Aug. 2, 2000
76B Subfamily
CYP76B1 Helianthus tuberosus (Jerusalem artichoke)
GenEMBL Y09920 (1742bp) Y10098 (1685bp)
Batard,Y., LeRet,M., Schalk,M., Zimmerlin,A., Durst,F. and
Werck-Reichhart,D.
Molecular cloning and functional expression in yeast of CYP76B1, a
xenobiotic-inducible 7-ethoxycoumarin O-deethylase from Helianthus
tuberosus.
unpublished (1997)
CYPYAN2
CYP76B2 petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee
IMT-1
CYP76B3 Medicago sativa (alfalfa)
no accession number
Chris Steele
clone TF26
submitted to nomenclature committee
CYP76B4 Medicago sativa (alfalfa)
no accession number
Chris Steele
clone A231
submitted to nomenclature committee
sequence below released directly from Chris Steele
This sequence is not in Genbank (1/19/01)
>19 A231 76B4 Length: 509 July 30, 1997 Medicago sativa (alfalfa)
1 MDMLQSSTLS YLVIIFTFSM LLLIKFLIPT NKTNQKNHSK LPPGPSPLPI
51 IGNLLKLGNK PHHSLANLSN IHGPIMTLKL GQVTTIVISS ADIAKEVLQT
101 HDTLLSNRTV PDALSVLNHD QYSLSFMRVS PRWRDLRKIC NNQLFSNKTL
151 DSSQALRRRK LQDLLDDIKK CSEIDEAVDI GRVAFMTTIN LLSNTFFSAD
201 FVHSAEEAGE YKEIVVSILK EVGAPNLSDF FPMLTVFDLQ GIRRRSVVSV
251 KKVLSIFRRF VGERLKLREG TGSIENDDVL DALLNISLDD GKIEMDKDEI
301 EHLLLNIFVA GTDTTTYTLE WAMAELMHNP EIMSKVQKEL EQVVGKGIPI
351 QETDIAKLPY MQAVIKETFR LHPPVPLLLP RKAETDVEIG DYIIPKDAQV
401 LVNAWVIGRD PNKWDNANVF VPERFLDSEI DVKGHHFELI PFGSGRRICP
451 GLPLAIRMLP MMLGSLVNCF DWKLEDGLNI DDLNKEDEYG ITLEKSQPVR
501 IVPIKLTIQ
CYP76B5 petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 9/26/98
IMT-7 56% identical to 76B1, 62% identical to 76B2
CYP76B6 Catharanthus roseus (Madagascar periwinkle)
no accession number
G. Collu, J. Memelink and R. Verpoorte
submitted to nomenclature committee 1/14/99
67% identical to 76B2, 66% to 76B5, 53% with 76B3 and 76B4,
61% with 76B1
CYP76B7 Pastinaca sativa (wild parsnip)
No accession number
Art Zangerl and May Berenbaum
See webworms and parsnips website http://www.life.uiuc.edu/berenbaum
40% to 76A7 54% to 76B1 58% to 76B2 50% to 76B3 50% to 76B4 57% to 76B5 61% to 76B6
48% to 76C2 42% to 76D1 48% to 76E1 49% to 76F1 54% to 76F2 38% to 76G1 43% to 76H1
and 76H2 53% to 76J1
submitted to nomenclature committee 1/29/02
76C Subfamily
CYP76C1 Arabidopsis thaliana
GenEMBL AC003680 F17K2.9 Also D78600
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-4
CYP76C2 Arabidopsis thaliana
GenEMBL AC003680 F17K2.10
ESTS H37250, T04013, T04014, T04015, T04016, T04017, Z33828, Z34697
CYP76C3 Arabidopsis thaliana
GenEMBL AC003680 F17K2.11
no ESTs
CYP76C4 Arabidopsis thaliana
GenEMBL AC003680 F17K2.8
CYP76C5 Arabidopsis thaliana
GenEMBL AC010164 93429-96444
clone F14M2
CYP76C6 Arabidopsis thaliana
GenEMBL AC010164 comp(88950-90642)
clone F14M2
CYP76C7 Arabidopsis thaliana
No accession number yet
clone T27I15 contig 5 from European Chr. 3 project
contains CYP76C7 and CYP76C8P
CYP76C8P Arabidopsis thaliana
No accession number yet
clone T27I15 contig 5 from European Chr. 3 project
contains CYP76C7 and CYP76C8P
76D Subfamily
CYP76D1 Cicer arietinum (chickpea)
GenEMBL AB032833 (1310 bp)
Overkamp,S., Hein,F. and Barz,W.
Cloning and characterization of elicitor induced cytochrome P450s
from chickpea cell suspension cultures
Unpublished (1999)
CYP76D1 Cicer arietinum (chickpea)
GenEMBL AB026263
Ichinose,Y., Tiemann,K., Schwenger-Erger,C., Toyoda,K., Hein,F.,
Hanselle,T. and Barz,W.
Genes Expressed in Ascochyta rabiei-Inoculated-Chickpea Plants and
Elicited Cell Cultures as Detected by Differential
cDNA-Hybridization
Unpublished (1999) internal fragment from C-helix on most like 76B (35%)
CYP76E1 Medicago sativa (alfalfa)
no accession number
Chris Steele
clone A11
submitted to nomenclature committee
sequence below released directly from Chris Steele
This sequence is not in Genbank (1/19/01)
>22 From Chris Steele (5/15/98) alfalfa 76E1 A11
searched nr 4/1/2000
MDHQTLLLVI TFVSATILIF FLRKSNQTQN STKLPPGPYP LPIIGNILEL
GKNPHKALTK LSKIYGPIMT LKLGSITTIV ISSPQVAKQV LHDNSQIFSN
RTVPHAITAV DHDKFSVGWV PTLNLWKKLR KNCATKVFST KMLDSTKILR
QQKLQELLDY VNEKSHNGEV FDIGETVFIN VLNSISNTLF SMDLAHSTPD
EKSQEFKTII WGIMEEAGKP NISDFFPILR PLDPQGLYAR MTNHMKKLCE
IFDGIIEERI CLKDSKGDYE VCNDVLDSLL NINIGEATSE LSRNEMVHLF
LDLFVAGIDT TSSMIEWIIA ELLRNPDKLT KVRKELCQTI GKGETIEESH
ISKLPFLQAV VKETFRLHPP IPLLLPHKCD ELVNILDFNV PKNAQVLVNV
WAMGRDPAIW DNPNTFVPER FMECDINYKG NNFELIPFGA GKRICPGLPL
AHRTMHLMVA SLLHNFEWNL ADGLIPEHLN MDEQFGLTLK RVQPLRVEAI
SSA
CYP76F1 Cicer arietinum
GenEMBL AJ249799, AJ249802
Stefan Overkamp and Wolfgang Barz
submitted to nomenclature committee 9/27/99
41% to 76A1, 46% to 76B1, 44% to 76C2, 46% to 76D1, 47% to 76E1
This sequence is identical to CYP81D9. Both are partial sequences
One of the names needs to be retired.
NSARVMTLKLGQVTTVVISSADMAKEVLLTHDLITSNRTVPDAL
SVLNHDQYSLSFMRVSPRWRDLRKICNYQLFSNKTLDSSQALRRRKLQDLLNDIERCS
KVGEAVDVGKAAFKTTVNLLSNTFFSVDFVHSAKEAGEYKEIIVSILKEVGVPNVSDF
FPMLKFLDLQGIRKRSIVSVKKVLSIFKRFVGERVKMREGTGSIGNDDVLDALLNMSS
DGGKIEMDKDEIEHLLLNIFVAGTDTTTYTLEWAMAELIHNPEMMSKLKEELEKTVGK
GIPVEETDIAKLPYMQAVIKETFRLHPPVPLLLPRRAEIDVKIGDYVIPKDAQILINA
WVVGRDPTKWENPNVFIPERFLDSEIDIKGHHFELIPFGSGRRTCPGLPLAIRMLPLM
LGSLVNCFDWKLEDGLNVEDFNKEDEFGITLEKSQPVRIVPTKLY
CYP76F2 Vitis vinifera (grape)
GenEMBL AJ237995
Davies,C. and Robinson,S.P.
Differential screening indicates a dramatic change in mRNA
Profiles during grape berry ripening. Cloning and characterization
of cDNAs encoding putative cell wall and stress response proteins.
Plant Physiol. 122, 803-812 (2000)
mRNA for putative ripening-related P-450 enzyme (gfh2 gene)
53% identical to CYP76F1
CYP76G1 Arabidopsis thaliana
GenEMBL AL132966
F08J02 from the EU Chr 3 project comp(64780-66639)
CYP76H1 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
Clone name 76-12 prime
Submitted to nomenclature committee 6/4/2001
86% to 76H2 and 76H3
CYP76H2 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
Clone name 76-11
Submitted to nomenclature committee 6/4/2001
95% to 76H3
CYP76H3 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
Clone name 76-17a
Submitted to nomenclature committee 6/4/2001
95% to 76H2, 36% to 76A6, 41% to 76B4, 45% to 76C2,
41% to 76D1 partial seq, 40% to 76E1, 46% to 76F2, 39% to 76G1
CYP76J1 Petunia
no accession number
Hiromasa Imaishi
submitted to nomenclature committee 7/24/98
clone IMT-8
77A Subfamily
CYP77A1 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X71656 (1683bp) Swiss P37123 (499 amino acids)
PIR S41599 S40267 (499 amino acids)
Toguri,T. and Tokugawa,K.
Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
belonging to a novel family (CYP77)
FEBS Lett. 338, 290-294 (1994)
Note: clone name H1
CYP77A2 Solanum melongena cv. Sinsadoharanasu (eggplant)
GenEMBL X71655 (1673bp) Swiss P37124 (511 amino acids)
PIR S41598 S40266 (511 amino acids)
Toguri,T. and Tokugawa,K.
Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
belonging to a novel family (CYP77)
FEBS Lett. 338, 290-294 (1994)
Note: clone name H2
CYP77A3 Glycine max (soybean)
GenEMBL AF022464 (1644bp)
Siminszky,B., Dewey,R.E. and Corbin,F.T.
clone name 6/10
CYP77A4 Arabidopsis thaliana
GenEMBL B97241
GSS fragment BAC end T32M21TR
note: contains N-terminal 65% identical to 77A3
No ESTs
CYP77A5P Arabidopsis thaliana
GenEMBL AP000414 13981-14298 fragment
65% identical to 77A2 with an in frame stop codon and
several frameshifts in the PERF to heme region
identical match to EST H36337 clone 178A11T7
opposite end = AA651240 clone 178A11XP 3', mRNA sequence
matches AP00414 from 16129-16750 = 3 prime UTR
CYP77A6 Arabidopsis thaliana
GenEMBL AC011560 71181-72725 clone F13M14 also on AC013428
No introns
CYP77A7 Arabidopsis thaliana
GenEMBL AC011560 72998-74939 clone F13M14 also on AC013428
No introns
CYP77A8P Arabidopsis thaliana
GenEMBL AB010077
Pseudogene fragments
51066-51110 (26-40), 56196-56252 (167-185),
56264-56377 (195-232), 75123-75146 (233-240)
CYP77B1 Arabidopsis thaliana
GenEMBL AC007296 comp(89516-91048)
45% to 77A3 sequences no introns
ESTs Z30775, Z30776 noGSSs
78A Subfamily
CYP78A1 Zea mays (maize)
GenEMBL L23209 (2087bp)
Larkin,J.C.
Isolation of a cytochrome P450 homologue preferentially expressed
in developing inflorescences of Zea mays L
Unpublished (1993)
CYP78A2 Phalaenopsis sp. hybrid SM9108 (moth orchid)
GenEMBL U34744 (1799bp)
Nadeau,J.A., Zhang,X., Li,J. and O'Neill,S.D.
Molecular Characterization of Ovule Development: Isolation of
Stage- and Tissue-specific cDNAs.
unpublished (1995)
CYP78A3 Glycine max (soybean)
GenEMBL AF022463 (1611bp)
Siminszky,B., Dewey,R.E. and Corbin,F.T.
clone name 6/4
CYP78A4 Pinus radiata (Monterey pine)
GenEMBL AF049067
Bishop-Hurley,S.L., Walter,C. and Gardner,R.C.
Isolation and Expression of Abundant mRNAs during Somatic
Embryogenesis of Pinus radiata
Unpublished
CYP78A5 Arabidopsis
GenEMBL AC027656 comp(32530-34190)
Susan Carr Zondlo
submitted to nomenclature committee Sept. 22, 1998
58% identical to 78A2
EST T45256
CYP78A6 Arabidopsis thaliana
GenEMBL AC005819 AC006418
65% identical to 78A3
CYP78A7 Arabidopsis thaliana
GenEMBL AC016893
59% identical to 78A4 and 78A1
CYP78A8 Arabidopsis thaliana
GenEMBL AC007323 comp(15232-17051)
62% identical to 78A6
no ESTs no GSSs
CYP78A9 Arabidopsis thaliana
GenEMBL AB036059
Toshiro Ito
submitted to nomenclature committee 9/9/99
81% identical to 78A6
EST AI995549 no GSSs
CYP78A9 Arabidopsis thaliana
GenEMBL AB036059
contig 31 of clone F21F14 from the EU chr 3 project
8955-10728 numbering will change as contigs are joined
(formerly confidential)
CYP78A9 Arabidopsis thaliana
GenEMBL AL138642 (chr 3 F21F14)
CYP78A10 Arabidopsis thaliana
GenEMBL AC016662
CYP78A11 Oryza sativa (rice)
GenEMBL AC083943.6 25-JUL-2001
clone OSJNBa0044A10, 61% to 78A7
also submitted by Ahn Byoung-Ohg and N. Kurata 10/31/2001
40753 MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLAFATAAVLAWAASPGGPAWAHGRGRLGA 40965
40966 TPIEGPRGLPVFGSIFALSRGLPHRALDAMSRDAAAPRARELMAFSVGETPAVVSSCPAT 41145
41146 AREVLAHPSFADRPLKRSARELLFARAIGFAPSGEYWRLLRRIASTHLFSPRRVAAHEPG 41325
41326 RQADATAMLSAMAAEQSATGAVVLRPHLQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQ 41505
41506 LKSMVREGFELLGAFNWSDHLPWLAHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRD 41685
41686 SSSTAADNADFVDVLLSLEAHENLAEDDMVAVLW 41787 (phase 0 intron)
41874 EMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMP 42035
42036 YLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 42215
42216 EAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWF 42395
42396 LPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA* 42506
79A Subfamily
CYP79A1 Sorghum bicolor
GenEMBL U32624
Koch, B.M., Sibbessen, O., Halkier, B.A., Svendsen, I. and Lindberg Moller, B.
Arch. Biochem. Biophys. 323, 177-186 (1995)
CYP79A2 Arabidopsis thaliana (thale cress)
GenEMBL AB010692 comp(11000-13200 region)
about 53% identical to 79A1
Note: this sequence was included in 79A when there was only one
other CYP79A sequence. Now that there are several, this sequence
does not really fit well in the CYP79A subfamily. However, the
name will remain the same for historical reasons.
CYP79A3P Arabidopsis thaliana
GenEMBL AB025602 14755-16760
Stop codon in Heme signature and frameshifts at K-helix and after
Heme signature. Probable pseudogene but alternative C-terminal lies beyond.
88% identical to 79A2
CYP79A4P Arabidopsis thaliana
GenEMBL AB025602 22090-22536
Lone C-terminal exon. Note: this exon may join with N-terminal exons of
CYP79A3P to make a complete P450 gene. The natural last exon my be skipped.
same as GSS B61504
CYP79A5 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
58% to 79A1
clone name 79A14
submitted to nomenclature committee July 18, 2000
CYP79A6 Triticum aestivum (wheat)
No accession number
Daniele Werck-Reichhart
96% to 79A5
clone name 79A1
submitted to nomenclature committee July 18, 2000
CYP79A7 Oryza sativa (rice)
GenEMBL AC084319.5
complement(join(117988..118644,121556..122530))
also AC091302.3
58% to 79A1
MSEAMAVTMPPMRAPALVAMLVVVLVALVRRRRHRSKGAGGRLESLPP
GPVGLPVIGNMHQMLVNKPVFRWVHRLLADAGGEIVCVRLGPVHVVAVTSPEMAREVL
RKNDAVFADRPTTFAAESFSVGYRSASISPHGDQWRKMRRVLTAEILSPATEHRLRGA
RGEEADHLVRYVLVRCGRDGAAVDVRHVARHFCGNVIRRLTLGRRHFREPRADDEDAA
APGRDEAEHVDALFATLNYLDAFCVSDYFPALVGLDLDGQEKVIKKVMRTLNRLHDPV
VEERVEEWRLLRKAGERRDVADFLDVLASLDDAAGRPLLTVEEIKAQTIDIMIATVDN
PSNAVEWALAEMMNKPEVMRKAMDELDTVVGRDRLVQESDVRDLNYLKACIREAFRLH
PYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYP
AGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGV
ERVELREEAASLVLAQPLVLQATPRLAAHLYGAGK
CYP79A8 Hordeum vulgare (barley)
No accession number
Soren Bak and Katrine Pontoppidan
Submitted to nomenclature committee 4/9/02
CYP79A9 rice
See rice pages
CYP79A10 rice
See rice pages
CYP79A11 rice
See rice pages
CYP79A12 Hordeum vulgare (barley)
No accession number
Kirsten Nielsen
Submitted to nomenclature committee 5/21/03
79B Subfamily
CYP79B1 Sinapis alba (white mustard)
GenEMBL AF069494 (1886 bp)
Bak,S., Nielsen,H.L. and Halkier,B.A.
The presence of CYP79 homologues in glucosinolate-producing plants
shows evolutionary conservation of the enzymes in the conversion of
amino acids to aldoximes in the biosynthesis of cyanogenic
glucosides and glucosinolates.
Plant Mol. Biol. 38, 725-734 (1998)
CYP79B2 Arabidopsis thaliana (thale cress)
GenEMBL AF069495 (1370 bp) AL035708 T5J17.120 complete sequence
Bak,S., Nielsen,H.L. and Halkier,B.A.
The presence of CYP79 homologues in glucosinolate-producing plants
shows evolutionary conservation of the enzymes in the conversion of
amino acids to aldoximes in the biosynthesis of cyanogenic
glucosides and glucosinolates.
Plant Mol. Biol. 38, 725-734 (1998)
ESTs T42902 from C-helix on
Contig 1510 of the TIGR Landsberg erecta sequences has 99% match
Hull, A.K., Vij, R. and Celenza, J.L. (2000)
Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent
Indole-3-acetic acid biosynthesis.
PNAS Early Edition (preprint)
Converts trp to indole-3-acetic acetaldoxime (IAOx)
CYP79B3 Arabidopsis
GenEMBL AC006592 comp(103303-105685) also AC007168 76873-79255
85% identical to 79B2
no ESTs no GSSs
Hull, A.K., Vij, R. and Celenza, J.L. (2000)
Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent
Indole-3-acetic acid biosynthesis.
PNAS Early Edition (preprint)
Converts trp to indole-3-acetic acetaldoxime (IAOx)
CYP79B4P Arabidopsis
GenEMBL AC006592 comp(101836-101952) and comp(102489-102605)
also AC007168 79953-80069 and 80606-80722 clone T26C19
lone exons at C-terminal
CYP79B5 rape
No accession number
Barbara Halkier
Submitted to nomenclature committee 6/7/00
%identity (aa level) to other CYP79s is: 44.1 to E1, 44.1 to E2,
50.8 to D1, 51.4 to D2, 95.9 to B1, 93.5 to B2, 85.3 to B3,
52.0 to A1, 48.4 to A2, 38.4 to F1, 38.4 to F2, 41.0 to C1.
79C Subfamily
CYP79C1 Arabidopsis thaliana (thale cress)
GenEMBL AC002986 comp(75-1680) AC007202 comp(77381-79610)
C-terminal missing from AC002986. Intron sequence after PKG runs off the end
of the DNA on the complementary strand. AC007202 complete
Contig 505 and 1241 of the TIGR Landsberg erecta sequences have 100% matches
CYP79C2 Arabidopsis thaliana (thale cress)
GenEMBL AC008051 1899-4148
this gene has four frameshifts in a preliminary version of the sequence. It may be a
pseudogene there are three pseudogene fragments associated with it CYP79C3P,
CYP79C4P and CYP79C5P
chromosome 1, 52% to 79C1
CYP79C3P Arabidopsis thaliana (thale cress)
GenEMBL AC008051 5709-6541
CYP79C4P Arabidopsis thaliana (thale cress)
GenEMBL AC008051 7210-7435
CYP79C5P Arabidopsis thaliana (thale cress)
GenEMBL AC008051 9049-9895
79D Subfamily
CYP79D1 Manihot esculenta (cassava)
GenEMBL AF140613
Mette Dahl Andersen
submitted to nomenclature committee
clone val152
CYP79D2 Manihot esculenta (cassava)
GenEMBL AF140614
Mette Dahl Andersen
submitted to nomenclature committee
clone val211
CYP79D3 Lotus japonicus
No accession number
Soren Bak
submitted to nomenclature committee Feb. 7, 2003
clone name sequence 1
CYP79D4 Lotus japonicus
No accession number
Soren Bak
submitted to nomenclature committee Feb. 7, 2003
clone name sequence 2
79E Subfamily
CYP79E1 Triglochin maritima
GenEMBL AF140609
Nielsen,J.S. and Moller,B.L.
Cloning and expression of cytochrome P450 enzymes catalyzing the
conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
biosynthesis of cyanogenic glucosides in Triglochin maritima
Plant Physiol. 122 (4), 1311-1321 (2000)
clone tri 361
CYP79E2 Triglochin maritima
GenEMBL AF140610
Nielsen,J.S. and Moller,B.L.
Cloning and expression of cytochrome P450 enzymes catalyzing the
conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
biosynthesis of cyanogenic glucosides in Triglochin maritima
Plant Physiol. 122 (4), 1311-1321 (2000)
submitted to nomenclature committee 3/26/99
95% identical to CYP79E1
CYP79F1 Arabidopsis thaliana
GenEMBL AC006341 comp(63874-66127)
46% identical to 79C1 less with other 79s
ESTs F14189, F14190
CYP79F2 Arabidopsis thaliana
GenEMBL AC006341 comp(60246-62290)
89% identical to 79F1 no ESTs 98% identical to GSS B20058
80A Subfamily
CYP80A1 Berberis stolonifera
GenEMBL U09610
Kraus.P.F.X. and Kutchan,T.M.
Molecular cloning and heterologous expression of a cDNA encoding
berbamunine synthase, a C-O phenol-coupling cytochrome P450
from the higher plant Berberis stolonifera.
unpublished (1994)
submitted to nomenclature committee
80B Subfamily
CYP80B1v1 Eschscholzia californica (California poppy)
GenEMBL AF014800 (1901bp)
Pauli,H.H. and Kutchan,T.M.
Molecular cloning and functional heterologous expression of two
alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
new methyl jasmonate-inducible cytochrome P-450-dependent
monooxygenase of benzylisoquinoline alkaloid biosynthesis
Plant J. 13, 793-801 (1998)
HP1
41.8% identical to 80A1
CYP80B1v2 Eschscholzia californica (California poppy)
GenEMBL AF014801 (1613bp)
Pauli,H.H. and Kutchan,T.M.
Molecular cloning and functional heterologous expression of two
alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
new methyl jasmonate-inducible cytochrome P-450-dependent
monooxygenase of benzylisoquinoline alkaloid biosynthesis
Plant J. 13, 793-801 (1998)
HP3
99% identical to 80B1v1 possible allele
CYP80B2 Coptis japonica (Japanese goldthread)
no accession number
Fumihiko Sato
Submitted to nomenclature committee 3/21/99
70% identical to CYP80B1
clone name CYPCJA
CYP80B3 Papaver somniferum (opium poppy)
GenEMBL AF191772
Facchini,P.J. and Yu,M.
cDNA cloning and characterization of (S)-N-methylcoclaurine
3'-hydroxylase (CYP80B1) from elicitor-treated opium poppy cell
suspension cultures
Unpublished
81A Subfamily
Note: The 81 and 91 families have been joined due to new Arabidpsis sequences that have
strong sequence identity to both families. The CYP91 family sequences have been
renamed with new CYP81 family names. The old names will still be recognized, but the
newer names will be preferred.
CYP81A1 Zea mays
Sharon Potter
sequence g
submitted to nomenclature committee
CYP81A2 Zea mays
Sharon Potter
sequence h
submitted to nomenclature committee
CYP81A3 Zea mays
Sharon Potter
sequence i
submitted to nomenclature committee
CYP81A4 Zea mays
Sharon Potter
sequence k
submitted to nomenclature committee
ESTs AI920363 (100% match) AI947634 (1 amino acid difference)
81B Subfamily
CYP81B1v1 Helianthus tuberosus (Jerusalem artichoke)
GenEMBL AJ000477
Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
Werck-Reichhart,D.
Cloning, expression in yeast, and functional characterization of
CYP81B1, a plant cytochrome P450 that catalyzes In-chain
hydroxylation of fatty acids
J. Biol. Chem. 273, 7260-7267 (1998)
CYPYAN also called CYP81B1c
CYP81B1v2 Helianthus tuberosus (Jerusalem artichoke)
GenEMBL AJ000478
Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
Werck-Reichhart,D.
Cloning, expression in yeast, and functional characterization of
CYP81B1, a plant cytochrome P450 that catalyzes In-chain
hydroxylation of fatty acids
J. Biol. Chem. 273, 7260-7267 (1998)
also called CYP81B1l
CYP81B2 tobacco
no accession number
Yamada
tobacco sequence 1
submitted to nomenclature committee
CYP81B Oryza sativa (rice)
GenEMBL AF140486 partial sequence
57% to 81B1v1 over C-terminal fragment
81C Subfamily
CYP81C1 tobacco
no accession number
Yamada
tobacco sequence 3
submitted to nomenclature committee
CYP81C2 tobacco
no accession number
Yamada
tobacco sequence 4
submitted to nomenclature committee
81D Subfamily
CYP81D1 formerly CYP91A1 (families joined)
Arabidopsis thaliana
D78606 (500 amino acids)
Mizutani,M., Ward,E. and Ohta,D.
Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
cDNAs, differential expression, and RFLP mapping of multiple
cytochromes P450
Plant Mol. Biol. 37, 39-52 (1998)
P450-65
CYP81D1 Arabidopsis thaliana
GenEMBL AB026661 comp(8484-10672)
CYP81D2 Arabidopsis thaliana
GenEMBL Z99707 C7A10.10 C-terminal fragment
AL035601 F6G17.10 complete sequence
GSS AQ250603
CYP81D2 Arabidopsis thaliana
GenEMBL AL161591 possibly 9 genes
complement(join(60895..61509,61614..62000,62132..62629))
CYP81D3 Arabidopsis thaliana
GenEMBL Z99707 C7A10.20
Complete sequence
CYP81D3 Arabidopsis thaliana
GenEMBL AL161591 possibly 9 genes
CDS complement(join(58723..59340,59438..59824,59979..60476))
CYP81D4 Arabidopsis thaliana
GenEMBL Z99707 C7A10.30
Complete sequence
CYP81D4 Arabidopsis thaliana
GenEMBL AL161591 possibly 9 genes
complement(join(56317..56919,56990..57364,57839..58339))
CYP81D5 Arabidopsis thaliana
GenEMBL Z99707 C7A10.40
Complete sequence
CYP81D5 Arabidopsis thaliana
GenEMBL AL161591 possibly 9 genes
CDS complement(join(53512..54114,54191..54574,54960..55460))
CYP81D6 Arabidopsis thaliana
GenEMBL AC002391 T20D16.15
Complete sequence
CYP81D7 Arabidopsis thaliana
GenEMBL AC002391 T20D16.18
Complete sequence
CYP81D8 formerly CYP91A3 (families joined)
Arabidopsis thaliana
GenEMBL AL035601 F6G17.20
65% identical with 81D1
ESTs AA586064, N38687, T41596, H76015
CYP81D8 formerly CYP91A3 (families joined)
GenEMBL AL161591 possibly 9 genes
complement(join(63742..64353,64451..64834,64952..65449))
CYP81D9X Cicer arietinum (chickpea)
GenEMBL AJ249802
Stefan Overkamp
submitted to nomenclature committee 4/28/99
60% identical to 81D8 over J-helix to end of gene
Note: 81D9 and 76F1 seem to be the same sequence
One of the names must be discontinued. This seq is partial
And this reflects the difficulties of assigning a name to a partial
sequence. The best match to 81D9 is a grape P450 AJ237995
the grape seq seems to belong to the 76 family, so 76F1 is correct
This is a problem I should have caught, but missed.
PPVEETDIAKLPYMQAVIKETFRLHPPVPLLLPRRAEIDVKIGD
YVIPKDAQILINAWVVGRDPTKWENPNVFIPERFLDSEIDIKGHHFELIPFGSGRRTC
PGLPLAIRMLPLMLGSLVNCFDWKLEDGLNVEDFNKEDEFGITLEKSQPVRIVQLNCI
ENMFRLLQFMRR
CYP81D10 Arabidopsis thaliana
GenEMBL AC013288 14837-27604 clone T12I7
74% to 81D2 chromosome I
GSSs B23310 B21261 no ESTs
CYP81D11 Arabidopsis thaliana
GenEMBL AP002057 comp(8441-10208)
chromosome 3, BAC clone T19N8, 67% to 81D2
ESTs T14177 Z29010, Z29011, Z26103, H77232, F14118
81E Subfamily
CYP81E1 formerly CYP91A4 (families joined)
Glycyrrhiza echinata_ L. (licorice; Fabaceae)
GenEMBL AB001379 or D89431
Akashi,T., Aoki,T., Kameya,N., Nakamura,I. and Ayabe,S.
Two new cytochrome P450 cDNAs (Accession Nos. AB001379 and
AB001380) from elicitor-induced licorice (Glycyrrhiza echinata L.)
cells (PGR97-167)
Plant Physiol. 115, 1288 (1997) Ge-3
50.1% identical to 81D1
Akashi, T., Aoki, T. and Ayabe, S.
CYP81E1, a cytochrome P450 cDNA of licorice (Glycyrrhiza echinata L.)
encodes isoflavone 2'-hydroxylase.
Biochem. Biophys. Res. Commun. 251, 67-70 (1998)
CYP81E1v2 Glycyrrhiza echinata
GenEMBL AB022732
Akashi,T., Aoki,T. and Ayabe,S.
A cytochrome P450 cDNA from cultured Glycyrrhiza echinata L. cells
unpublished (1999) In press
CYP Ge-31 97% identical to CYP81E1
MDILSLLSYSVFYLALFFIFNIVIRARKFKNLPPGPPSLPIIGN
LHHLKRPLHRTFKGLSEKYGHVISLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRF
LSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLITRLA
DDSSTNFAEIELSYRFYDMTFNNIMRMISGKRYYGEDCDMSDLQEASQFRDMVSELLQ
LSGANNKTDFMPLLRFLDFENLEKRLKDISGKTDAFLRGLIQEHRAKKERANTMIDHL
LNLQDSQPEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVKDELDT
HVGQDRLVDESDLPKLSYLKNVINETLRLYTPAPLLLPHSTSDECNIGGYKVPQDTIV
LINAWAIHRDPELWTEATTFKPERFEKKGELEKLIAFGMGRRACPGEGLAIRAISMTL
ALLIQCFDWKLTNGDKIDMAERDGFTLTKLVPLKAMCKSRPVINKVFKQ
CYP81E2 formerly CYP91A5
Cicer arietinum (chickpea)
GenEMBL AJ239051
Overkamp,S., Hein,F. and Barz,W.
Isolation of elicitor induced cytochrome P450 sequences from
chickpea (Cicer arietinum) cell suspension cultures
Unpublished
submitted to nomenclature committee, sequence revised 5/20/99
52.7% identical to CYP81E1
CYP81E3v1 Cicer arietinum (chickpea)
GenEMBL AJ012581
Stefan Overkamp and Wolfgang Barz
Cloning of Two Cicer arietinum L.
cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s
Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
Plant Physiol. 120, 935 (1999)
86% identical to CYP81E1 from licorice
CYP81E3v2 Cicer arietinum (chickpea)
GenEMBL AJ238439
Stefan Overkamp and Wolfgang Barz
Cloning of Two Cicer arietinum L.
cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s
Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
Plant Physiol. 120, 935 (1999)
(revised sequence sent 4/28/99)
85% identical to CYP81E1 from licorice
96% identical to 81E3v1 (6 amino acid differences in N-terminal 20 amino acids)
CYP81E4 Cicer arietinum (chickpea)
GenEMBL AJ249801
Stefan Overkamp
62% identical to 81E1 from I-helix to end of gene
84% identical to 81E5
submitted to nomenclature committee 8/17/99 revised 9/6/99
IRHEIQAMLLAGTDTSAVTIEWVMSELLNHPDVLKQSKRRNRTQ
IGKDKLIEEHDLSKLPYLQNIINETLRLHPPAPLSLPHYSSEDFTLGGFNVPKDTIIL
TNVWAIHRDPKYWSDASSFKPERFEIDGELNKLIAFGLGRRACPGQSLAHRTVGLTLG
LLIQCFEWKRETEEKIDLREGKGLTMPMGVPLKAMCKPLPIANYIIS
CYP81E5 Cicer arietinum (chickpea)
GenEMBL AJ249800
Stefan Overkamp
submitted to nomenclature committee 9/16/99
84% identical to 81E4
CYP81E6 Lotus japonicus
GenEMBL AB025016
Shimada,N., Aoki,T. and Ayabe,S.
A cytochrome P450 cDNA from Lotus japonicus
Unpublished April 4, 2000
CYP81E7 Medicago truncatula (barrel medic)
No accession
Chang-Jun Liu
submitted to nomenclature committee 3/10/2003
clon