This page was last modified Feb. 14, 2003. 

Plant P450s that have appeared since the 1993 P450 nomenclature update.
Part D of the bibilographic P450 documents.  These files were broken into 
      five parts to reduce the download time for each part. 
      This includes references that were incomplete and duplications
      of sequences that were already in the update.  If a sequence 
      is assigned an accession number that was not in the old update
      it is included in this list.  Some expressed sequence tags (ESTs)
      are also included from Arabidopsis thaliana and Catharanthus roseus.
      This list was last modified August 29, 2001. (added 76J1 
      sequence to this file.  This is not in Genbank)

Plant P450 families are numbered CYP51, CYP71 to CYP99.  The numbers then jump to 
      701-726, because there are 51 plant P450 families.  Many of the 
      sequences included here are PCR fragments or expressed sequence tags
      that are quite short.  These fragments have not been
      assigned to families, unless a clear family resemblance was present.
      CYP51 is the only family conserved enough to be identified as the
      same family across kingdoms, including plants, fungi, animals and 
      bacteria.
      In the Arabidopsis expressed sequence tags, some are from the C-
      terminal and some are from the N-terminal or middle region of the
      P450s.Clearly some are from the same sequence, but the relationship
      cannot be known until the whole sequence is complete, or 
      until PCR primers from the fragments can be used to identify
      which fragments are in the same sequence.

Note: at least one plant sequence has been reported that shows a P450 spectrum and 
P450 activity, but the sequence does not appear to be a P450 family member based on 
descent from a common ancestor. (GenEMBL D64052, tobacco, Biochim. Biophys. Acta 
1308, 231-240 1996)  This sequence when blastn searched shows highest similarity to 
rRNA.  

BLASTN-outcome:D64052     Tobacco mRNA for cytochrome P450 like seq. 10050  0.0   
   1emb|Z11498|MSRRN26S   M.sativa 26S rRNA                                     1034  4.5e-311

So D64052 is not a P450 but a ribosomal RNA.
Nitric oxide synthases have a heme thiolate spectrum.  A heme thiolate ligand is 
not restricted to P450 family members.  It is ironic that the name cytochrome P450 
derives from a characteristic spectrum, but not all proteins with this spectrum can 
be included in the family of cytochrome P450s.  This family is now defined by 
sequence, and not spectral properties.

Note: First 71D sequences are in GenBank 71D6 and 71D7 (see below)

51 Family

71A Subfamily

71B Subfamily

71C Subfamily

71D Subfamily

71E Subfamily

72A Subfamily

72B Subfamily

73A Subfamily

74A Subfamily

74B Subfamily

75A Subfamily

76A Subfamily

76B Subfamily

76C Subfamily

76D Subfamily

77A Subfamily

78A Subfamily

79A Subfamily

79B Subfamily

79C Subfamily

79D Subfamily

79E Subfamily

80A Subfamily

80B Subfamily

81A Subfamily

81B Subfamily

81C Subfamily

81D Subfamily

81E Subfamily

81F Subfamily

81G Subfamily

81H Subfamily

82A Subfamily

82B Subfamily

82C Subfamily

82D Subfamily

82E Subfamily

82F Subfamily

83A Subfamily

83B Subfamily

83C Subfamily

83D Subfamily

84A Subfamily

85A Subfamily

86A Subfamily

87A Subfamily

88A Subfamily

89A Subfamily

90A Subfamily

90B Subfamily

91A Subfamily

92A Subfamily

92B Subfamily

93A Subfamily

93B Subfamily

93C Subfamily

93D Subfamily

94A Subfamily

95A Subfamily

96A Subfamily

96B Subfamily

97A Subfamily

97B Subfamily

98A Subfamily

99A Subfamily

701A Subfamily

702A Subfamily

703A Subfamily

704A Subfamily

705A Subfamily

706A Subfamily

707A Subfamily

708A Subfamily

709A Subfamily

709B Subfamily

710A Subfamily

711A Subfamily

712A Subfamily

713A Subfamily

714A Subfamily

715A Subfamily

716A Subfamily

716A Subfamily

716A Subfamily


51 Family

CYP51       Sorghum bicolor
            GenEMBL U74319
            Bak,S., Kahn,R.A., Olsen,C.E. and Halkier,B.A. 
            Cloning and expression in Escherichia coli of the obtusifoliol 14
            alpha-demethylase of Sorghum bicolor (L.) Moench, a cytochrome P450 
            orthologous to the sterol 14 alpha-demethylases (CYP51) from fungi and mammals
            Plant J. 11 (2), 191-201 (1997).

CYP51       Triticum aestivum (wheat)
            GenEMBL Y09291 (1655bp)
            Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A,    
            Werck-Reichhart D
            Optimized expression and catalytic properties of a wheat obtusifoliol
            14alpha-demethylase (CYP51) expressed in yeast Complementation
            of erg11Delta yeast mutants by plant CYP51.
            Eur J Biochem  262,435-446 1999 

CYP51       Triticum aestivum (wheat)
            GenEMBL Y09292 (1231bp)
            Cabello-Hurtado F, Taton M, Forthoffer N, Kahn R, Bak S, Rahier A, 
            Werck-Reichhart D
            Optimized expression and catalytic properties of a wheat obtusifoliol
            14alpha-demethylase (CYP51) expressed in yeast Complementation
            of erg11Delta yeast mutants by plant CYP51.
            Eur J Biochem  262,435-446 1999 

CYP51A1     Arabidopsis thaliana
            GenEMBL AC002329 Complete sequence
            GenEMBL AC007127 comp(82241-84323) complete seq.
            Contig 1783 of the TIGR Landsberg erecta sequences has 99% match

CYP51A2     Arabidopsis thaliana
            GenEMBL AC007296 comp(52507-54167) 
            GenEMBL N65031 (EST fragment)
            GenEMBL AA651059 (EST fragment) opposite end AA720360
            These ESTs are similar but not identical to CYP51A1.
            76% to CYP51A1

CYP51       Zea mays
            GenEMBL T12664 (EST fragment)

CYP51       Oryza sativa (rice)
            GenEMBL    AB025047
            Aoyama,Y., Horiuchi,T. and Yoshida,Y.
            Cloning and characterization of rice sterol 14-demethylase (CYP51) gene.
            Unpublished

CYP51       Pinus taeda (pine)
            GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
            BF610290.1 CYP51 N-term
MDFIQNIYVQAGLLILATLVLAKIVSSILGFGSSKNLPPMVPAWPIVGGLMKFLKGPIVMLR
EEYPKLGNVFTIKLLIKNVTFLIGPEVSQHFFKXPESDL
CYP51 C-term
LXHDVLAXXDVLYRCIKEALRLHPPLIVLLRSNHRDFTVTAKDGKDYVIPKGHVVATSPAFANRLPHIFKNPDT
YDPDRFVPGREEDKVGGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFELELISP
FPEIDWNAMVVGVKDKVMVRYRRRPLSVD*
      
71A Subfamily

CYP71A1     Persea americana (avocado)
            PIR A44973 (40 amino acids)
            GenEMBL M32855
            O'Keefe, D.P. and Leto, K.J.
            Cytochrome P-450 from the mesocarp of avocado (Persea
            americana).
            Plant Physiol. 89, 1141-1149 (1989)

CYP71A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL D14990 (1744bp) X71654 (1747bp) 
            Swiss P37118 (505 amino acids) PIR S36806 (505 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name 154 also called CYPEG4

CYP71A3     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70982 (1096bp) Swiss P37119 (365 amino acids)
            PIR S36807 (365 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name F151 also called CYPEG3

CYP71A4     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70981 (1724bp) Swiss P37117 (507 amino acids)
            PIR S36805 (507 amino acids)
            Umemoto,N., Kobayashi,O., Ishizaki-Nishizawa,O. and Toguri,T.
            cDNAs sequences encoding cytochrome P450 (CYP71 family) from
            eggplant seedlings.
            FEBS Lett. 330, 169-173 (1993)
            Note: clone name E138 also called CYPEG2
            Incorrectly called CYP71A1 in Genbank entry

CYP71A5v1   Nepeta racemosa (catmint, source of catnip)
            GenEMBL Y09423(1703bp)
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)
            note: sequence is revised from original submission on 9/10/98

CYP71A5v2     Nepeta racemosa (catmint, source of catnip)
            GenEMBL 
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)
            note: a second allele

CYP71A6     Nepeta racemosa (catmint, source of catnip)
            GenEMBL Y09424(1697bp)
            Clark, I.M., Forde, B.G. and Hallahan, D.L.
            Spatially distinct expression of two new cytochrome P450s in leaves
            of Nepeta racemosa: identification of a trichome-specific isoform.
            Plant Mol. Biol. 33, 875-885 (1997)

CYP71A7     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69779 (346bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 7 from Fig. 2.

CYP71A8     Mentha piperita
            GenEMBL Z33875 (2141bp)
            Kang,M.H. and Choi,Y.D.
            Molecular cloning of a genomic DNA for cytochrome P-450 oxidase
            from Mentha piperita.
            unpublished (1994)

CYP71A9     Glycine max (soybean)
            GenEMBL Y10489 (1603bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP1

CYP71A10    Glycine max (soybean)
            GenEMBL AF022157 (1838bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            capable of catalyzing the metabolism of phenylurea herbicides

CYP71A11X   tobacco
            no accession number 
            Takashi Yamada
            tobacco sequence 2
            submitted to nomenclature committee 9/9/97
            renamed CYP71AH1 only 46% to 71B38

CYP71A12    Arabidopsis thaliana
            GenEMBL AC002340
            T11J7.14

CYP71A13    Arabidopsis thaliana
            GenEMBL AC002340
            T11J7.16 
            ESTs H76866, AA605540

CYP71A14      Arabidopsis thaliana
            GenEMBL AF069716 10000-14000 region
            GenEMBL AC005964 comp(3688-6807)
            67% identical to CYP71A13
            no ESTs 

CYP71A15      Arabidopsis thaliana
            GenEMBL AF069716 16000-19000 region
            GenEMBL AC005964 comp(1066-1380) partial seq.
            no ESTs

CYP71A16      Arabidopsis thaliana
            GenEMBL AB022210 comp(26631-24211)
            64% identical to 71A14 ESTs AA395422, T43806

CYP71A17P    Arabidopsis thaliana
           GenEMBL AB017065 comp(19000-21000 region)
           64% identical to 71A14 
           clear pseudogene, missing large regions including I-helix

CYP71A18     Arabidopsis thaliana
            GenEMBL AC007296 83847-85677 
            86% identical to 71A12 
            no ESTs no GSSs

CYP71A19        Arabidopsis thaliana
           GenEMBL AL049608 
           join(11443..11829,12066..12542,12626..12907,13106..13432)
          gene T9E8.30 64% identical to 71A16 no ESTs no GSSs

CYP71A20        Arabidopsis thaliana
           GenEMBL AL049608 
           join(21221..21598,21753..22253,22331..22612,23485..23811)
          gene T9E8.50 88% identical to CYP71A19 no ESTs no GSSs

CYP71A21        Arabidopsis thaliana
           GenEMBL AL049659 comp(61576..62187,62279..63139) 
           gene T29H11.160
           also U31288 fragment at end of another gene and GSS B25921 no ESTs

CYP71A22        Arabidopsis thaliana
           GenEMBL AL049659 comp (64631..65242,65328..66188) 
           gene T29H11.170 EST N38590

CYP71A23        Arabidopsis thaliana
           GenEMBL AL049659 comp (67262..67861,68005..68856) 
           gene T29H11.180

CYP71A24        Arabidopsis thaliana
           GenEMBL AL049659 comp(70246..71784) 
           gene T29H11.190 
           Genbank translation has a retained intron before the I-helix

CYP71A25        Arabidopsis thaliana
           GenEMBL AL049659 comp (73216..73830,73929..74786) 
           gene T29H11.200
           ESTs T22148, AA395671, AI100632

CYP71A26    Arabidopsis thaliana
            GenEMBL AL049659 comp(76207..76818,76952..77809) 
            T29H11.210

CYP71A27    Arabidopsis thaliana
            GenEMBL AL022224
            F1C12.160a  (parts from two genes are represented as one gene) 
            this is the first gene
            61% identical to CYP71A20
            note formerly 713A1

CYP71A28    Arabidopsis thaliana
            GenEMBL AL022224
            F1C12.160b  (parts from two genes are represented as one gene)
            this is the second gene 
            60% identical to CYP71A20
            note formerly 713A2

71B Subfamily

CYP71B1     Thlaspi arvense
            GenEMBL L24438 (1648bp)
            Udvardi,M.K., Metzger,J.D., Krishnapillai,V., Peacock,W.J. and
            Dennis,E.S.
            Cloning and nucleotide sequence of a full length cDNA from Thlaspi arvense
            that encodes a cytochrome P-450.
            Plant Physiol. 104, 755-756 (1994)

CYP71B2     Arabidopsis thaliana
            D78605 (502 amino acids) also AC007357 31915-33510
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-48 nearly identical to Z18072 and Z35218 ESTs

CYP71B3     Arabidopsis thaliana
            D78602 (501 amino acids) also AB024038 COMP(43851-45465)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-13-1
            Contig 885 of the TIGR Landsberg erecta sequences has 100% match

CYP71B4     Arabidopsis thaliana
            D78603 (504 amino acids) also AB024038 comp(78016-79595)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-13-6
            same as EST T21833, AI100749 GSSs B12539, B10642

CYP71B5     Arabidopsis thaliana
            D78601 (498 amino acids) also AL132958
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-12

CYP71B6     Arabidopsis thaliana
            D78604 (503 amino acids)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            ESTs F15479, F14179
            P450-23
            identical to AC005967

CYP71B7      Arabidopsis thaliana
            GenEMBL X97864 (1684bp) also AC007357 33975-41560
            Maughan.J.A., Nugent, J.H.A. and Hallahan, D.L.
            expression of CYP71B7 a cytochrome P450 expressed sequence tag
            from Arabidopsis thaliana.
            unpublished (1996)
            full length sequence of 5 ESTs R65111, T44310, T04541, T04814, T44875
            Contig 610 of the TIGR Landsberg erecta sequences has 100% match

CYP71B8       Arabidopsis thaliana
            GenEMBL AB011485 27121-28820

CYP71B9      Arabidopsis thaliana
            GenEMBL AC004136
            47% identical to 71B7
            no ESTs

CYP71B10       Arabidopsis thaliana
            GenEMBL AB019233 comp(24311 - 22750)
            71% identical to AC004136
            no ESTs no GSS (1/13/99)

CYP71B11 Arabidopsis thaliana
            GenEMBL AC006259 (94-702) partial seq.
            GenEMBL AC005964 (66557-68105) whole seq.
            BAC F21J6 from chromosome V mapping near 60.5 cM
            69% identical to 71B1
            ESTs Z33963, Z33677 GSSs B28673, B78204 and AQ011301

CYP71B12 Arabidopsis thaliana
            GenEMBL AC006259 (4286-6376)
            GenEMBL AC005964 (72227-73777)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            92% identical to 71B11

CYP71B13 Arabidopsis thaliana
            GenEMBL AC006259 (9294-10829)
            GenEMBL AC005964 (76695-78230)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            70% identical to 71B1

CYP71B14 Arabidopsis thaliana
            GenEMBL AC006259 comp(30932-32475)
            BAC F21J6 from chromosome V mapping near 60.5 cM
            68% identical to 71B1

CYP71B15       Arabidopsis thaliana
           GenEMBL AB016889 (54457-56024)
           62% identical to 71B7

CYP71B16         Arabidopsis thaliana
            GenEMBL AB024038 comp(13279-14849)
            84% identical to CYP71B17
            no ESTs no GSSs

CYP71B17         Arabidopsis thaliana
            GenEMBL AB024038 comp(15932-17496)
            84% identical to CYP71B17
            no ESTs no GSSs

CYP71B18         Arabidopsis thaliana
            GenEMBL AB024038 comp(18098-19609)
            80% identical to CYP71B17 
            ESTs AA650762, T44224, AI099821 (2 diffs)
            T44855 (3 diffs) GSS B25335
            missing an internal 21 amino acid fragment and frame shift after 
            first 6 N-terminal  amino acids. may be a pseudogene

CYP71B19         Arabidopsis thaliana
            GenEMBL AB024038 comp(21194-22760)
            ESTs H76241
            60% identical to 71B2

CYP71B20         Arabidopsis thaliana
            GenEMBL AB024038 comp(26044-27630)
            94% identical to CYP71B19
            ESTs T04186, T45449, T21193, AA585920 (1 diff)
            T20987 (3 diffs) no GSSs

CYP71B21         Arabidopsis thaliana
            GenEMBL AB024038 comp(31112-32720)
            88% identical to 71B22 
            no ESTs no GSSs

CYP71B22         Arabidopsis thaliana
            GenEMBL AB024038 36984-38609
            88% identical to CYP71B21
            no ESTS no GSSs

CYP71B23         Arabidopsis thaliana
            GenEMBL AB024038 comp(40969-42839)
            71% ident to 71B7 
            no ESTs no GSSs

CYP71B24         Arabidopsis thaliana
            GenEMBL AB024038 comp(45837-47529)
            80% identical to 71B3 no ESTs 
            GSS AQ011201 (5 diffs/178 = 97%) B96063 4 diffs/126 = 97% these
            may be a related gene.

CYP71B25         Arabidopsis thaliana
            GenEMBL AB024038 comp(75254-76832)
            74% identical to 71B4 
            no ESTs no GSSs

CYP71B26         Arabidopsis thaliana
            GenEMBL AB024038 comp(80407-82076)
            68% identical to 71B9 
            very similar to Z33952, Z34037 (91% identical) but different gene

CYP71B27         Arabidopsis thaliana
             GenEMBL AB007357 28180-29804 
             GSSs B11396, B21019 no ESTs

CYP71B28         Arabidopsis thaliana
             GenEMBL AB007357 34549-36103 
             ESTs T20906, T76255, T14112, N65665, AI100027

CYP71B29         Arabidopsis thaliana
             GenEMBL AB007357 36686-38241 
             similar to GSS B21027

CYP71B30P    Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             82204-83671 missing N-term 80 AA not found between end of 71B5 and start 
             of this sequence probably a pseudogene
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B31     Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             84593-86302 GSSs AL092788 (clone T10J6) AL081333 (clone F2M19) No ESTs
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B32     Arabidopsis thaliana
             GenEMBL AL132958
             Clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs 
             (71B30P, 71B31, 71B32) and 97C1 (formerly a confidential sequence)
             87497-89156 two in frame stop codons may be a pseudogene
             clone F4P12  from the EU Chr 3 project overlaps T04D02 and contains 
             two of the three new 71Bs and part of the third

CYP71B33     Arabidopsis thaliana
             GenEMBL AP001298 comp(479-2126)

CYP71B34     Arabidopsis thaliana
             GenEMBL AP001298 comp(2977-4644)

CYP71B35     Arabidopsis thaliana 
             GenEMBL AP001298 comp(4867-6557)

CYP71B36     Arabidopsis thaliana
             GenEMBL AP001298 comp(8161-9842)

CYP71B37     Arabidopsis thaliana
             GenEMBL AP001298 comp(10654-12314)
             EST Z27299

71C Subfamily

CYP71C1     Zea mays (maize)
            GenEMBL X81827 (1890bp) X81828 (4352bp)
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)

CYP71C1     Zea mays
            GenEMBL AF004210 (1185bp)
            Sisco,P.H.
            agr(c94) random cDNA clone from Zea mays etiolated coleoptiles
            Unpublished

CYP71C2     Zea mays (maize)
            GenEMBL X81829 (1786bp) 
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)

CYP71C2v2   Zea mays
            Sharon Potter
            sequence b
            submitted to nomenclature committee

CYP71C2     Zea mays (maize)
            GenEMBL Y11404 (3130bp)
            Gierl, A.
            unpublished (1997)

CYP71C3     Zea mays (maize)
            GenEMBL X81830 (1800bp)
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)

CYP71C3     Zea mays (maize)
            GenEMBL Y11403 (5057bp)
            Gierl, A.
            unpublished (1997)

CYP71C3v2   Zea mays (maize)
            no accession number
            Persans,M. and Schuler,M.
            unpublished (1995)
            note:  Maize strain used in Schuler's lab = B73, Frey's lab used CI31A

CYP71C4     Zea mays (maize)
            GenEMBL X81831 (1878bp)
            Frey,M., Kliem,R., Saedler,H. and Gierl,A.
            Expression of a cytochrome P450 gene family in maize
            Mol. Gen. Genet. 246, 100-109 (1995)

CYP71C4     Zea mays (maize)
            GenEMBL Y11368 (7466bp)
            Gierl, A.
            unpublished (1997)

CYP71C5     Zea mays
            Sharon Potter
            sequence a
            submitted to nomenclature committee
            55% to 71C4

CYP71C6     Triticum aestivum (wheat)
            no accession number
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C1 (79% identical)

CYP71C6     Triticum aestivum (wheat)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-2
            probable orthologue to CYP71C1 (79% identical)
            100% identical to 71C6 of Werck

CYP71C7v1   Triticum aestivum (wheat)
            no accession number
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C2 (76% identical)

CYP71C7v2   Triticum aestivum (wheat)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-3
            probable orthologue to CYP71C2 (76% identical)
            96% identical to 71C7v1 of Werck

CYP71C8v1   Triticum aestivum (wheat)
            no accession number
            Daniele Werck
            submitted to nomenclature committee 1/20/99
            probable orthologue to CYP71C3 (78% identical)

CYP71C8v2   Triticum aestivum (wheat)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-4
            probable orthologue to CYP71C3 (78% identical)
            95% identical to 71C8v1 of Werck

CYP71C9v1   Triticum aestivum (wheat)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-5
            probable orthologue to CYP71C4 (78% identical)
            97% identical to 71C9v2

CYP71C9v2   Triticum aestivum (wheat)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 4/30/2000
            clone name N-6
            probable orthologue to CYP71C4 (78% identical)
            97% identical to 71C9v1

CYP71C9v2   Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            submitted to nomenclature committee July 23, 2001
            76% identical to 71C4
            clone C4-38
            100% identical to Dr. Imaishis sequence

CYP71C10    Triticum aestivum (wheat) formerly CYP71H1
            No accession number
            Daniele Werck-Reichhart 
            55% to 71C4 but only 50% to 71C8, 56% to 71C11
            clone name 71F8I2
            submitted to nomenclature committee July 18, 2000
            This sequence has been reassigned to the 71C subfamily
            It is on the outskirts of the subfamily, but new sequences 
            force it to belong there rather than in a new subfamily.

CYP71C11    Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            submitted to nomenclature committee Jan 6, 2001
            58% identical to 71C7, 57% to 71C6 and 56% identical to 71C10

CYP71C-like Hordeum vulgare (barley)
            GenEMBL AJ000231
            Hess,W.R.
            Analysis of randomly selected cDNAs from white leaves of the
            albostrians mutant of barley
            Unpublished
      GQRMCPGMNLVNHFDWELPIGIESIDMTEVFGITIRRKEKLLLIPKSRL
            68% identical to C-terminal of 71C4

71D Subfamily

CYP71D1     Catharanthus roseus
            GenEMBL AY192573
            Schroeder,J.
            submitted to nomenclature committee

CYP71D2     Catharanthus roseus
            GenEMBL AY192574
            Schroeder,J.
            submitted to nomenclature committee

CYP71D3X    Arabidopsis thaliana
            GenEMBL Z27299
            62% amino acid identity to CYP71D1
            this short EST fragment belongs to 71B37

CYP71D4     Solanum tuberosum cv. Datura (potato)
            GenEMBL AJ296346
            Michel Schneider 
            56.1% identical to CYP71D1
            induced rapidly by Phytophthora infestans infection or wounding
            (pesonal communication from Michel Schneider)

CYP71D5    Nicotiana tabacum (tobacco)
           no accession number
           Simon Warner
           submitted to nomenclature committee

CYP71D6      Solanum chacoense (Chaco potato)
           GenEMBL U48434 (1641bp)
           Hutvagner, G., Barta, E. and Banfalvi, Z.
           Isolation and sequence analysis of a cDNA and related gene for 
           cytochrome P450 from Solanum chacoense.
           Gene 188 (2), 247-252 (1997)

CYP71D7    Solanum chacoense (Chaco potato)
           GenEMBL U48435 (3107bp)
           Hutvagner, G., Barta, E. and Banfalvi, Z.
           Isolation and sequence analysis of a cDNA and related gene for 
           cytochrome P450 from Solanum chacoense.
           Gene 188 (2), 247-252 (1997)

CYP71D8     Glycine max (soybean)
            GenEMBL Y10493 (1800bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP7

CYP71D9     Glycine max (soybean)
            GenEMBL Y10490 (1754bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)
            clone CP3

CYP71D10    Glycine max (soybean)
            GenEMBL AF022459 (1691bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 5/16

CYP71D11    Lotus japonicus
            GenEMBL AF000403 (1641bp)
            Szczyglowski,K., Hamburger,D., Kapranov,P. and de Bruijn,F.J.
            Construction of a Lotus japonicus late nodulin expressed sequence
            tag library and identification of novel nodule-specific genes
            Plant Physiol. 114 (4), 1335-1346 (1997)

CYP71D12    Catharanthus roseus (Madagascar periwinkle)
            GenEMBL AJ238612 (1682 bp)
            Schroeder,G., Unterbusch,E., Kaltenbach,M., 
            Schmidt,J., Strack,D., De Luca,V., and Schroeder,J.:
            Light-induced cytochrome P450-dependent enzyme in 
            indole alkaloid biosynthesis: tabersonine 
            16-hydroxylase. 
            FEBS Lett. 458, 97-102 (1999)
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submited and named earlier than Lupiens sequence.

CYP71D12X   Mentha spicata (spearmint) Renamed as CYP71D18
            GenEMBL AF124815
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            unpublished
            submitted to nomenclature committee 1/24/99
            50% identical to 71D7, 69% identical to 71D13
            (-)4S-Limonene-6-Hydroxylase
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submitted and named earlier than Lupiens sequence.

CYP71D13      Mentha X piperita (peppermint)
            GenEMBL AF124816
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            unpublished
            submitted to nomenclature committee 1/24/99
            69% identical to 71D12
            (-)4S-Limonene-3-Hydroxylase
            clone name PM17

CYP71D14     Petunia hybrida (petunia)
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee June 4, 1999
            58% to 71D6 
            IMT-5 

CYP71D15      Mentha X piperita (peppermint)
            GenEMBL AF124817
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            unpublished
            submitted to nomenclature committee 1/24/99
            69% identical to 71D12, 92% identical to 71D13
            (-)4S-Limonene-3-Hydroxylase
            clone name PM2

CYP71D16       Nicotiana tabacum
           GenEMBL AF166332
           Wang,E., Wang,R., Deparasis,J., Gan,S. and Wagner,G.J.
           Isolation of a cytochrome P450 gene from tobacco
           Unpublished
           54% to 71D5 also a tobacco sequence
MQFFNFFSLFLFVSFLFLFKKWKNSNSQTKRLPPGPWKLPILGS
MLHMLGGLPHHVLRDLAKKYGPIMHLQLGEVSLVVISSPGMAKEVLKTHDLAFANRPL
LVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIKFF
RSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKEQDEFVQLVKKVSNLIEGFDVADIFP
SLKFLHVLTGMKAKVMNTHNELDAILENIINEHKKTSKSDGESGGEGIIGVLLRLMKE
GGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVEMMKNPSVFSKAQAEVREILRG
KETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNA
WAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRRICPGISFGLANVYFP
LAQLLNHFDWKLPTGINPRNCDLTEAAGAACARKNDLHLIATAYQHCEE

CYP71D17    Prunus dulcis chloroplast  (almond)
            GenEMBL AF107765
            Ma,R. and Oliveira,M.M.
            A putative Prunus dulcis cytochrome P450 gene sequence
            Unpublished
            chloroplast gene encoding chloroplast protein, partial cds.
            70% identical to 71D sequences these sequences may be chloroplast P450s
MFVPRECREKCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPDSFNPDRFLDSSIDY
KGTNFEYIPFGAGRRMCPGMSFGLANVELPLALLLYHFDWKLPDG

CYP71D18    Mentha spicata (spearmint) Formerly CYP71D12
            GenEMBL AF124815
            Shari Lupien, Rodney Croteau
            Regio-Specific Cytochrome p450 Limonene Hydroxylases From Mint
            (mentha) Species
            unpublished
            submitted to nomenclature committee 1/24/99
            50% identical to 71D7, 69% identical to 71D13
            (-)4S-Limonene-6-Hydroxylase
            Note: due to a mistake on my part the name 71D12 was assigned
            to two sequences.  The sequence of Schroeder has priority
            Since it was submitted and named earlier than Lupiens sequence.

CYP71D19    Capsicum annuum (pepper)
            GenEMBL AF122821
            Oh,B.J., Ko,M.K., Kim,Y.S., Kim,K.S., Kostenyuk,I. and Kee,H.K.
            A cytochrome P450 gene is differentially expressed in compatible
            and incompatible interactions between pepper (Capsicum annuum) and
            the anthracnose fungus, Colletotrichum gloeosporioides
            Mol. Plant Microbe Interact. 12 (12), 1044-1052 (1999)
            58% to 71D6

CYP71D20    Nicotiana tabacum (tobacco)
            GenEMBL AF368376
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Sept. 22, 2000
            81% to 71D4
            gene 1

CYP71D21    Nicotiana tabacum (tobacco)
            GenEMBL AF368377
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Sept. 22, 2000
            82% to 71D4
            gene 2

71E Subfamily

CYP71E1     Sorghum bicolor
            GenEMBL AF029858
            Soren Bak, Rachel Alice Kahn, Hanne Linde Nielsen, Birger
            Lindberg Moller, Barbara Ann Halkier
            Cloning of three A-type cytochromes P450, CYP71E1,
            CYP98, and CYP99 from Sorghum bicolor (L.) Moench by
            a PCR approach and identification by expression in
            Escherichia coli of CYP71E1 as a multifunctional
            cytochrome P450 in the biosynthesis of the cyanogenic
            glucoside dhurrin.
            Plant Molecular Biology 36 (3):393-405, 1998.

CYP71E2     Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 3/29/2000
            clone name 71g
            58% identical to 71E1 37% to 71F1, 41% to 71G1 and G2

CYP71E3X     Triticum aestivum (wheat) name changed to CYP71M3
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 6/4/2001
            clone name 71-2
            52% identical to 71E1 51% to 71E2, 43% to 71A11
            46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
            42% to 71G1v1, 40% to 71J, 38% to 71K

CYP71F1     Triticum aestivum (wheat)
            No accession number
            Hiromasa Imaishi
            40-42% identical to 71D sequences 43% identical to 71A1
            clone name N-1
            submitted to nomenclature committee 1/8/2000

CYP71G1v1   Asparagus
            No accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 3/2/2000
            clone name ASPI-1
            49% to CYP71A1, 40% to 71A14, 45% to 71E1, 43% to 71B9, 
            37% to 71D13, 37% to 71C1, 39% to 71F1

CYP71G1v2   Asparagus
            No accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 3/2/2000
            clone name ASPI-2
            99% to CYP71G1v1 (4 amino acids differences)

CYP71H1X    Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart 
            55% to 71C4 but only 50% to 71C8, 58% to 71C7
            clone name 71F8I2
            submitted to nomenclature committee July 18, 2000
            This sequence has been reassigned to the 71C subfamily
            It is on the outskirts of the subfamily, but new sequences 
            force it to belong there rather than in a new subfamily.

CYP71J1     Asparagus
            No accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 12/5/2000
            clone name ASPI-3
            47% to CYP71A1, less to other 71 subfamilies

>CYP71K1    Oryza sativa (rice)
            GenEMBL AP002968 
            46% to 71F1 40% to 71A11, 41% to 71G1v2
            40% to 71C7, 40% to 71B24 42% to 71D4 38% to 71E1
MAELPLYLLLLALLVAVPFLCLTRWSLRHGGGGGGRLPPSPWAL
PVIGHLHHVAGALPHRAMRDLARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAF
ATRPITPTGKVLMADSVGVVFAPYGDGWRTLRRICTLELLSARRVRSFRAVREEEVGR
LLRAVAAAAAVAALTTPGATAAVNLSERISAYVADSAVRAVIGSRFKNRAAFLRMLER
RMKLLPAQCLPDLFPSSRAAMLVSRMPRRMKRERQEMMDFIDDIFQEHHESRAAAGAE
EDLLDVLLRIQSQDKTNPALTNDNIKTVIIDMFVASSETAATSLQWTMSELMRNPRVM
RKAQDEVRRALAIAGQDGVTEESLRDLPYLHLVIKESLRLHPPVTMLLPRECRETCRV
MGFDVPEGVMVLVNAWAIGRDPAHWDSPEEFAPERFEGVGAADFKGTDFEYIPFGAGR
RMCPGMAFGLANMELALAALLYHFDWELPGGMLPGELDMTEALGLTTRRCSDLLLVPA
LRVPLRDHER

CYP71L1     Hordeum vulgare (barley)
            No accession number
            Kirsten A Nielsen
            Most like CYP71E about 50%
            submitted to nomenclature committee 5/16/2002
            526 amino acids

CYP71M1     Hordeum vulgare (barley)
            No accession number
            Kirsten A Nielsen
            Most like CYP71E about 50%
            submitted to nomenclature committee 5/16/2002
            514 amino acids
            only 42% to 71L1

CYP71M2     Sorghum bicolor 
            No accession number
            Kirsten A Nielsen
            70% to CYP71M1
            submitted to nomenclature committee 8/2/2002
            525 amino acids

CYP71M3     Triticum aestivum (wheat) formerly CYP71E3
            No accession number
            Daniele Werck-Reichhart
            Submitted to nomenclature committee 6/4/2001
            clone name 71-2
            52% identical to 71E1 51% to 71E2, 43% to 71A11
            46% to 71B10, 37% to 71C8, 40% to 71D2, 37% to 71F1
            42% to 71G1v1, 40% to 71J, 38% to 71K, 43% to 71L1, 92% to 71M1

CYP71N1     Musa acuminata (banana)
            GenEMBL AY062168
            Lee,Y.C. and Pua,E.C.
            Cloning and Characterization of Cytochrome P450 in Banana (Musa
            acuminata)
            Unpublished
            50% to 71G1 less to other CYP71 subfamilies

more names exist here for the rice P450s that have not been added yet to the nomenclature pages

CYP71R4     Lolium rigidum (ryegrass)
            No accession
            Hiromasa Imaishi
            Clone W1B11-HT
            63% to rice AP003575 CYP71R2P

more rice subfamilies belong here, not inserted yet

CYP71AH1    tobacco
            no accession number 
            Takashi Yamada
            tobacco sequence 2
            submitted to nomenclature committee 9/9/97
            Formerly 71A11, renamed CYP71AH1 only 46% to 71B38

72A Subfamily

Note on the 72A subfamily.  The 72A subfamily from different species appears to contain 
multiple members.  These sequences are very similar to each other, so they were not present in the common ancestor to the 72A group.  They may represent alleles of the same gene or duplications of a single gene that have diverged slightly.  I have tried to keep families with only one sequence per species with a single name as in CYP72A for all species.  This approach breaks down when multiple alleles or highly similar duplications are present.  The only practical solution is to assign different names to each species as in 72A1, 72A2, 72A3, etc. and use v1, v2, v3 for the highly similar variations in a single species.  Variants had already been assigned to 72A from Catharanthus roseus, but since this was one of the first cases where v numbers were used, the first sequence was not given a v designation.  The second sequence was called v1 and the third v2.  The nomenclature has since been defined such that any new sequence is by default given the v1 designation.  The v1 designation is not used unless other variants are known.  The second sequence is then v2 etc.  To correct this error, the first 72A1 sequence is being relabeled as 72A1v3, while the other two sequences remain the same.  Other species are now assigned different numbers as 72A2 etc. with v numbers given as needed.  It is still acceptable to refer to the 72A subfamily, but different species will now have separate numbers.

CYP72A1v1   Catharanthus roseus
            GenEMBL L19074 (2646bp)
            Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
            Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
            Gene and cDNA for plant cytochrome P450 proteins (CYP72 family) 
            from Catharanthus roseus: and transgenic expression in tobacco and 
            Arabidopsis thaliana.
            Plant Sci. 96, 129-136 (1994)
            Note: sequence called CYP72B, 8 amino acid differences with
            CYP72A1v3 (see second entry under 72A1v3 for function information)

CYP72A1v2   Catharanthus roseus
            GenEMBL L19075 (1633bp)
            Mangold,U., Eichel,J., Batschauer,A., Lanz,T., Kaiser,T.,
            Spangenberg,G., Werck-Reichhart,D. and Schroeder,J.
            Gene and cDNA for plant cytochrome P450 proteins (CYP72 family) 
            from Catharanthus roseus: and transgenic expression in tobacco and 
            Arabidopsis thaliana.
            Plant Sci. 96, 129-136 (1994)
            Note: sequence called CYP72C, 14 amino acid differences with
            CYP72A1v3 plus a 3 amino acid C-terminal extension.
            (see second entry under 72A1v3 for function information)

CYP72A1v3   Catharanthus roseus L. (Madagascar periwinkle)
            GenEMBL L10081 (1854bp) Swiss Q05047 (524 amino acids)
            Vetter,H.-P., Mangold,U., Schroeder,G., Marner,F.-J.,
            Werck-Reichhart,D. and Schroeder,J.
            Molecular analysis and heterologous expression of 
            an inducible cytochrome P-450 protein from periwinkle
            (Catharanthus roseus L.)
            Plant Physiol. 100, 998-1007 (1992)

NEW         Update on function of CYP72A1 encoded by (L10081):
            Irmler, S., Schršder, G., St-Pierre, B., Crouch, N.P., Hotze, M., 
            Schmidt, J., Strack, D., Matern, U. and Schršder, J. (2000) Indole 
            alkaloid biosynthesis in Catharanthus roseus: new enzyme activities 
            and identification of cytochrome P450 CYP72A1 as secologanin 
            synthase. Plant J. 24, 797-804.
            CYP72A1v3 converts loganin into secologanin.

            GenEMBL X69775 (365bp PCR fragment)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 3 from Fig. 2. (identical to 72A1)

CYP72A1     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69789 (375bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 1 from Fig. 2.
            (see second entry under 72A1v3 for function information)

CYP72A1     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69790 (327bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 2 from Fig. 2.
            (see second entry under 72A1v3 for function information)

CYP72A2    Nicotiana plumbaginifolia
           GenEMBL U35226(1787bp)
           LaRosa P.C. and Smigocki, A.C.
           A wound-inducible cytochrome P-450 in Nicotiana plumbaginifolia
           unpublished (1996)

CYP72A3X    Nicotiana tabacum (tobacco)
            no accession number
            Francis Durst
            submitted to nomenclature committee
            Francis Durst denies he ever sent a tobacco CYP72 sequence.  This is  
            Probably an accident, since he did send three tobacco sequences and 
            a wheat CYP72 in one email.  I probably thought they were all 
            tobacco and misnamed this one.

CYP72A4X    Arabidopsis thaliana ESTs
            GenEMBL T13009 (removed from Genbank, same as T04134), T04134 (72A11),     
            T22603 (72A13), H36956 (72A14), T44202 (72A13), R90024 (72A7)
            N-terminal fragments, more than one sequence is present

            GenEMBL T22449 (72A15), T45915 (72A15), H36129 (72A11)
            middle fragments

            GenEMBL Z46541 (72A14), Z46540 (72A14)
            C-terminal fragments

            note: the whole gene sequence can be assembled from these ESTs,
            but it may be a chimera of several isoforms.  There seem to be at 
            least 3 different N-terminals.  
            Note: There is a cluster of 8 CYP72A genes and one pseudogene on
            AB023038.  Therefore, this chimeric sequence has been retired.

CYP72A5    Zea mays
           no accession number (318 amino acids)
           Mike Persans and Mary Schuler
           submitted to nomenclature committee
           PCR4
           formerly CYP95A1 (missnamed due to a frame shift in the PCR fragment)
           ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)

CYP72A5    Zea mays (maize)
           no accession number
           Mike Barrett
           clone A8 most like PCR fragment PCR4 from Mike Persans and Mary Schuler
           The PCR4 fragment was missnamed as CYP95A1 due to a frame shift error in 
           the sequence in the I-helix region.
           also like Arabidopsis GSS BAC end fragment B24203 (67% identical)
           submitted to nomenclature committee 5/15/98
           ESTs AI855377 (1 amino acid difference), AI637224 (94% identical)

146 LLANGLVNHDGEKWAKHRRILNPAFHHEKIKGMMPVFSTCCIEMITRWDNSMPSEGSSEI
    DVWPEFQNLTGDVISRTAFGSNYQEGRRIFELQGELAERLIQSVQTIFIPGYWFLPTKNN
    RRMRAIDVEIRKILREIIGKREKDTKNRETNNDDLLGLLLESNTRQSNGNASLGLTTXDV
    IEECKLFYFAGMET 339

441 ASEFNPERFANGISXATRHQAAFFPFGGGPRICIGQSFALLEAKMTLCTILQRFSFELSP
    SXTHAPYXVITLHP 514

CYP72A6v1      Triticum aestivum (wheat)
           no accession number
           Daniele Werck
           submitted to nomenclature committee 1/20/99
           clone name CYP72A 47% identical to C. roseus CYP72A1

CYP72A6v2  Triticum aestivum (wheat)
           no accession number
           Daniele Werck
           submitted to nomenclature committee 1/20/99
           clone name CYP72B 
           This sequence is 100% identical to the other 72A6v2 sequence 
           from amino acid 130 to the end.  The N-terminal 129 amino acids match 
           no sequences in Genbank.  I suspect this is a chimeric clone. 

CYP72A6v2  Triticum aestivum (wheat)
           no accession number
           Daniele Werck
           submitted to nomenclature committee 1/20/99
           clone name CYP72B' 96% identical to CYP72A6v3 95% identical to  
           CYP72A6v1

CYP72A6v3  Triticum aestivum (wheat)
           no accession number
           Daniele Werck
           submitted to nomenclature committee 1/20/99
           clone name CYP72C 96% identical to CYP72A6v2 95% identical to CYP72A6v1

CYP72A7    Arabidopsis thaliana
           GenEMBL AB023038 40540-42460
           ESTs R90024 (2/26/99)

CYP72A8    Arabidopsis thaliana
           GenEMBL AB023038 42944-44810
           no ESTs (2/26/99)

CYP72A9    Arabidopsis thaliana
           GenEMBL AB023038 45458-47366
           no ESTs (3/1/99)

CYP72A10   Arabidopsis thaliana
           GenEMBL AB023038 47816-49744
           no ESTs (3/1/99)

CYP72A11   Arabidopsis thaliana
           GenEMBL AB023038 50166-52122
           ESTs H36129, T04134 (3/1/99)

CYP72A12P  Arabidopsis thaliana
           GenEMBL AB023038 52192-52485 lone exon 5
           GSS fragment B24203 97% identical
           no ESTs (3/1/99)

CYP72A13   Arabidopsis thaliana
           GenEMBL AB023038 52920-54868
           ESTs T44202, N96036, N96740 (3/1/99)

CYP72A14   Arabidopsis thaliana
           GenEMBL AB023038 62438-64419
           ESTs H36956, Z46541, Z46540 (3/1/99)

CYP72A15   Arabidopsis thaliana
           GenEMBL AB023038 65370-67267
           ESTs T45915, T22449 (3/1/99)

CYP72A16   Zea mays
           No accession number
           Jian Wang and Mary Schuler
           80% to 72A5 EST AI857222
           submitted to nomenclature committee 12/1/99

CYP72A17   Oryza sativa (rice)
           GenEMBL AP002839.1 36553-39431
            Go to sequences

CYP72A18   Oryza sativa (rice)
           GenEMBL AP002839.1 44993-41630
           Hiromasa Imaishi
           Submitted to nomenclature committee 8/18/2000
            Go to sequences

CYP72A19   Oryza sativa (rice)
           GenEMBL AP002839.1 comp(53699-51708)
            Go to sequences

CYP72A20   Oryza sativa (rice)
           GenEMBL AP002839.1 56581-59004
            Go to sequences

CYP72A21   Oryza sativa (rice)
           GenEMBL AP002839.1 61993-63890
           Hiromasa Imaishi
           Submitted to nomenclature committee 3/2/2000
           Clone name CL-8904
           53% identical to 72A15
            Go to sequences

CYP72A22   Oryza sativa (rice)
           GenEMBL AP002839.1 66435-68424
            Go to sequences

CYP72A23   Oryza sativa (rice)
           GenEMBL AP002839.1 72149-74091
            Go to sequences

CYP72A24   Oryza sativa (rice)
           GenEMBL AP002839.1 109970-113787
            Go to sequences

CYP72A25   Oryza sativa (rice)
           GenEMBL AP002839.1 115472-117492
            Go to sequences

CYP72A26    Zea mays (maize)
           No accession number
           Mary Schuler and Jian Wang
           Submitted to nomenclature committee Oct. 2, 2000 
           Clone name 12/7B
           62% to 72A5

CYP72A27    Zea mays (maize)
           No accession number
           Mary Schuler and Jian Wang
           Submitted to nomenclature committee Oct. 23, 2000 
           Clone name 11G
           95% identical to 72A26, but matches three ESTs at points of difference

CYP72A28   Zea mays (maize)
           No accession number
           Mary Schuler and Jian Wang
           Submitted to nomenclature committee Oct. 23, 2000 
           Clone name E5D
           66% to CYP72A26

CYP72A29   Solanum  tuberosum L. May Queen
           No accession  number
           Hisaharu Kato
           Submitted to nomenclature committee 1/15/2002
           84% to 72A2

CYP72A30   Lycopersicon esculentum (tomato)
             GenEMBL AF249329
           Bartoszewski,G., Mujer,C.V., Niemirowicz-Szczytt,K. and
           Smigocki,A.C.
           Tomato (Lycopersicon esculentum) cDNA sequence encoding a     
           protein similar to a cytochrome P450 enzyme
           Unpublished
           74% to 72A29
           note small gap compared to other 72As, may be missing some
           coding sequence 

72B Subfamily

CYP72B1     Arabidopsis thaliana ESTs
            GenEMBL AC003105
            42% identical to C. roseus 72A1
            ESTs T04442

CYP72B2X    Arabidopsis thaliana ESTs
            GenEMBL B96503 (661bp)
            F23A22TF 
            C-terminal PERF region to end
            This sequence is actually part of CYP714A1

CYP72C1    Arabidopsis thaliana
           GenEMBL AC007651 88180-91153
           45% identical to 72A9

73A Subfamily

CYP73A1     Helianthus tuberosus (Jerusalem artichoke) cinnamate 4-hydroxylase
            GenEMBL Z17369 (1620bp) Swiss Q04468 (505 amino acids)
            PIR S28495 A47454 (505 amino acids)
            Teutsch,H.G., Hasenfratz,M.P., Lesot,A., Stoltz,C., Garnier,J.-M.,
            Jeltsch,J.-M., Durst,F. and Werck-Reichhart,D.
            Isolation and sequence of a cDNA encoding the Jerusalem
            artichoke cinnamate 4-hydroxylase, a major plant cytochrome P450
            involved in the general phenylpropanoid pathway.
            Proc. Natl. Acad. Sci. USA 90, 4102-4106 (1993)

CYP73A2     Phaseolus aureus (mung bean) PIR listing has Vigna radiata (mung bean)
            GenEMBL L07634 (1766bp) PIR JC1458 (501 amino acids)
            PIR PC1238 (74 amino acids)
            Mizutani,M., Ward,E.R., DiMaio,J., Ryals,J.A., Ohta,D.
            and Sato,R.
            Molecular cloning and sequencing of a cDNA encoding
            mung bean cytochrome P450 (P450C4H) possessing cinnamate
            4-hydroxylase activity.
            Biochem. Biophys. Res. Commun. 190, 875-880 (1993)

CYP73A3     Medicago sativa (alfalfa) cinnamate 4-hydroxylase
            GenEMBL L11046 (1744bp) PIR S36878 (506 amino acids)
            Fahrendorf,T. and Dixon,R.A.
            Molecular cloning of the elicitor-inducible cinnamic acid
            4-hydroxylase cytochrome P450 from alfalfa.
            Arch. Biochem. Biophys. 305, 509-515 (1993)

CYP73A4     Catharanthus roseus (Madagascar periwinkle) PCR fragment
            GenEMBL X69788 (321bp)
            Meijer,A.H., Souer,E., Verpoorte,R. and Hoge,J.H.C.
            Isolation of cytochrome P-450 cDNA clones from the higher plant
            Catharanthus roseus by a PCR strategy.
            Plant Molec. Biol. 22, 379-383 (1993)
            Note: sequence 16 from Fig. 2.

CYP73A4     Catharanthus roseus (Madagascar periwinkle) 
            GenEMBL Z32563 (1713 bp) 
            Hotze,M., Schroeder, G. and Schroeder,J.:  
            Cinnamate 4-hydroxylase from Catharanthus roseus, 
            and a  strategy for the functional expression of 
            plant cytochrome P450 proteins as translational 
            fusions with P450 reductase in Escherichia coli. 
            FEBS Letters 374, 345-350 (1995) 

CYP73A5     Arabidopsis thaliana
            GenEMBL U71080 (5432bp) U71081 (1727bp)
            Bell-Lelong, D.A., Cusamano, J.C., Meyer, K. and Chapple, C.C.
            Cinnamate-4-hydroxylase expression in Arabidopsis.  Regulation
            in response to development and the environment.
            Plant Physiol. 113, 729-738 (1997)

CYP73A5     Arabidopsis thaliana
            GenEMBL U93215
            T06B20.16

CYP73A5     Arabidopsis thaliana
            GenEMBL U37235
            Mignotte-Vieux,C., Kazmaier,M., Urban,P. and Pompon,D.
            unpublished (1999)

CYP73A5     Arabidopsis thaliana
            GenEMBL D78596 (1711bp, 505 amino acids) also D78597 partial seq.
            Mizutani,M., Ohta,D. and Sato,R.
            Isolation of a cDNA and a genomic clone encoding cinnamate
            4-hydroxylase from Arabidopsis and its expression manner in planta
            Plant Physiol. 113, 755-763 (1997)
            P450C4H

CYP73A5     Arabidopsis thaliana EST
            GenEMBL T04086 (480bp) F19837 
            C-terminal fragment
            
CYP73A6     Zea mays
            Sharon Potter
            sequence e
            submitted to nomenclature committee 6/8/94

CYP73A7     Zea mays
            Sharon Potter
            sequence c
            submitted to nomenclature committee 6/8/94
            ESTs AI666136 AW519858.1 BG320001.1 BE639176.1
            php20835.x3.b an STS from the CSHL STS Maize Database    
            http://nucleus.cshl.org/maizegenome/
            currently missing 67 aa at N-terminal

                  IFL LRMGVRNLVV VSTPELAKEV LHTQGVEFGS 
RTRNVVFDIF TGKGQDMVFT VYGDHWRKMR RIMTVPFFTN KVVAQNRAGW 
EEEARLVVED VRKDPEAAAG GVVLRRRLQL MMYNDMFRIM FDRRFDSEHD 
PLFNKLKALN AERSRLSQSF EYNYGDFIPV LRPFLRGYLN RCHDLKTRRM 
KVFEDNFVQE RKXXMAQTGE IRCAMDHILE AERKGEINHD NVLYIVENIN 
VAAIETTLWS IEWGIAELVN HPAIQHKLRE ELASVLGAGV PVTEPDLERL 
PYLQAIVKET LRLRMAIPLL VPHMNLNDGK LAGYDIPAES KILVNAWFLA 
NDPKRWVRPD EFRPERFLEE EKSVEAHGND FRFVPFGVGR RSCPGIILAL 
PIIGITLGRL VQNFQLLPPP GLDKIDTTEK PGQFSNQIAK HATIVCKPLE 
A*

CYP73A8     Zea mays
            Sharon Potter
            sequence f
            submitted to nomenclature committee 6/8/94

CYP73A9      Pisum sativum (pea)
             GenEMBL U29243 (1715bp)
             Frank,M.R., Deyneka,J.M. and Schuler,M.A.
             Cloning of phenylpropanoid pathway P450 monooxygenases expressed in
             Pisum sativum.
             unpublished

CYP73A10    Petroselinum crispum (parsley)
            GenEMBL L38898 (1801bp)
            Logemann,E., Parniske,M. and Hahlbrock,K.
            Modes of expression and common structural features of the complete
            phenylalanine ammonia-lyase gene family in parsley
            Proc. Natl. Acad. Sci. U.S.A. 92, 5905-5909 (1995)
            sequence sent by Edda Koopmann

CYP73A11    Glycine max (soybean)
            GenEMBL X92437 (1787bp)
            Schopfer,C.R. and Ebel,J.
            Identification of elicitor-induced cytochrome P450s of soybean
            (Glycine max L.) using differential display of mRNA
            Mol. Gen. Genet. 258, 315-322 (1998)

CYP73A12    Zinnia elegans
            GenEMBL U19922 (1648bp)
            Ye, E. and Varner, J.E. 
            Expression patterns of cinnamic acid 4-hydroxylase gene during lignification
            in Zinnia. 
            unpublished

CYP73A13    Populus tremuloides (quaking aspen)
            GenEMBL U47293 (1803bp)
            Ge,L. and Chiang,V.L.
            A full length cDNA encoding trans-cinnamate 4-hydroxylase from developing 
            xylem of Populus tremuloides 
            Plant Physiol. 112, 861 (1996)

CYP73A14    Glycyrrhiza echinata (licorice)
            GenEMBL D87520
            Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
            Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
            and their transcriptional activation by elicitor treatment.
            Plant Science 126, 39-47 (1997)

CYP73A14v1  Glycyrrhiza echinata (licorice)
            GenEMBL D89430
            Akashi,T., Aoki, T., Takahashi,T., Kameya,N., Nakamura, I. and Ayabe, S.
            Cloning of cytochrome P450 cDNAs from cultured Glycyrrhiza echinata L. cells 
            and their transcriptional activation by elicitor treatment.
            Plant Science 126, 39-47 (1997)
            C-terminal PCR fragment with 4/82 amino acid differences to 73A14

CYP73A15    Phaseolus vulgaris (french bean)
            Y09447 (1799bp) Y09448 (2280bp) Y09449 (1065bp)
            Jupe,S.C., Werck-Reichhart,D. and Bolwell,G.P.
            Molecular cloning of a novel CYP73 from French bean: induction by
            elicitor and during xylogenesis.
            Unpublished

CYP73A16    Populus kitakamiensis (hybrid aspen)
            GenEMBL D82815(1737bp) mRNA
            GenEMBL D82814(2923bp) partial gene sequence
            GenEMBL D82812, D82813, D82814 closely related genes
            Kawai S, Mori A, Shiokawa T, Kajita S, Katayama Y, Morohoshi N.  
            Isolation and analysis of cinnamic acid 4-hydroxylase homologous genes from a 
            hybrid aspen, Populus kitakamiensis.  
            Biosci Biotech Biochem. 60, 1586-97

CYP73A17    Triticum aestivum (wheat)
            no accession number 
            Francis Durst
            submitted to nomenclature committee

CYP73A17    Triticum aestivum (wheat) 
            GenEMBL AF123608
            Batard,Y., Hehn,A., Nedelkina,S., Schalk,M., Pallett,K.,
            Schaller,H. and Werck-Reichhart,D.
            Increasing expression of P450 and P450-reductase proteins from
            monocots in heterologous systems
            Arch. Biochem. Biophys. 379 (1), 161-169 (2000)

CYP73A18    L. esculentum (tomato)
            GenEMBL Z70216 PCR fragment (202bp)
            this sequence differs from 73A24, but this might be due to errors
            there are no other ESTs that match this PCR fragment.

CYP73A19    Cicer arietinum (chickpea)
            GenEMBL AJ007449
            Overkamp, S. and W. Barz, W.  Isolation of a Full Length cDNA Encoding 
            Trans-Cinnamate 4-Hydroxylase (Accession No. AJ007449) from Chickpea (Cicer 
            arietinum L.). (PGR99-086) Plant Physiol. 120, 635 (1999)
            91% identical to Medicago sativa CYP73A3

CYP73A20    Pinus taeda (loblolly pine)
            GenEMBL AF096998
            Anterola,A.M., Jeon,J.H., Davin,L.B. and Lewis,N.G.
            Pinus taeda mRNA for trans-cinnamate 4-hydroxylase (PTC4H) is
            induced in cell suspension cultures by 8% sucrose/20mM KI treatment
            Unpublished

CYP73A21    Capsicum chinense (habanero chile)
            GenEMBL AF088847
            Curry,J. and O'Connell,M.A.
            Cinnamic acid 4-hydroxylase from habanero chile
            Unpublished

CYP73A22     Mesembryanthemum crystallinum
             GenEMBL AF097664
             Michalowski,C.B. and Bohnert,H.J.
             cinnamate 4-hydroxylase mRNA from the common ice plant
             Unpublished

CYP73A23    Pinus taeda
            GenEMBL AI812813, AA556941, AI812771, AI812842, AI919827
            sequence made from ESTs only
            missing 160 amino acids at N-terminal
            81% to 73A20 and many other 73A sequences

CYP73A24      tomato
           GenEMBL ESTs only
AI484139  EST248946 cLER1C5
AI894646  EST264089 cLEC4L12
AI490789  EST241497 cLEB3H9
AI774477  EST255577 cLER12O4
AI895653  EST265096 cLEC9O20
AI484136  EST248943 cLER1C5
AI899232  EST268675 cLED37P6
AI490786  EST241494 cLEB3H9
AI774140  EST255240 cLER10B24
AI773934  EST255034 cLER8N1
AI487946  EST246268 cLED19L20
AI484879  EST243140 cLED3A21
AI894393  EST263848 cLEC4G23
AI895830  EST265273 cLEC10A6
AI895463  EST264906 cLEC7J20

MDLLLLEKTLIGLFFAILIAIIISKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE 
YAKKFGDVFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVF 
TVYGEHWRKMRRIMTVPFFTNKVVQQYRGGWESEAASVVEDVKKN
PESATNGIVLRKRLQLMMYNNMFRIMFDRRFESEDDPLFVKLKALNGERS
RLAQSFEYNYGDFIPILRPFLRGYLKICKEVKEKRLKLFKDYFVDERKKL
ANTKSMDSNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEW
GIAELVNHPHIQKKLRDEIDTVLGPGVQVSEPDMPKLPYLQAVIKETLRL
RMAIPLLVPHMNLHDAKLAAYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVE 
ANGNDFRFLPFGVGSRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKLDTSEKGGQFSL 
HILKHSTIVMKPRSF*

CYP73A25    Gossypium arboreum (cotton)
            GenEMBL AF286647
            Xiao-Ya Chen and Ping Luo
            Clone name LP89
            92% to 73A16

CYP73A26    Gossypium arboreum (cotton)
            GenEMBL AF286648
            Xiao-Ya Chen and Ping Luo
            Clone name LP125
            91% to 73A25

CYP73A27    Nicotiana tabacum (tobacco)
            GenEMBL AF368378
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Oct. 10, 2000
            67% to 73A22, 71% to 73A15, 72% to 73A29
            clone name cDNA 1

CYP73A28    Nicotiana tabacum (tobacco)
            GenEMBL AF368379
            Ralston L, Kwon ST, Schoenbeck M, Ralston J, Schenk DJ, Coates RM, 
            Chappell J.
            Cloning, heterologous expression, and functional characterization of
            5-epi-aristolochene-1,3-dihydroxylase from tobacco 
            (Nicotiana tabacum).
            Arch Biochem Biophys. 2001 Sep 15;393(2):222-35.
            Submitted to nomenclature committee Oct. 10, 2000
            95% to 73A27
            clone name cDNA 2

CYP73A29    Citrus sinensis 
            GenEMBL AF255013.1
            Betz,C., McCollum,T.G. and Mayer,R.T.
            Differential expression of two cinnamate 4-hydroxylase genes in
            Citrus
            Unpublished            
            cinnamate 4-hydroxylase (C4H1)
            72% to 73A27

CYP73A30    Lithospermum erythrorhizon (a Japanese medicinal plant)
            No accession number
            Hajime Mizukami
            Submitted to nomenclature committee Oct. 25, 2000
            Clone name LEC4H1 83% to 73A4, 91% identical to 73A31

CYP73A31    Lithospermum erythrorhizon (a Japanese medicinal plant)
            No accession number
            Hajime Mizukami
            Submitted to nomenclature committee Oct. 25, 2000
            Clone name LEC4H2 91% identical to 73A30

CYP73A32    Ruta graveolens (common rue)
            GenEMBL AJ309127
            Antoine Gravot
            Submitted to nomenclature committee 3/29/01
            87% to cotton CYP73A25

CYP73A33    Sorghum bicolor 
            No accession number
            Ron Coolbaugh
            95% identical to 73A7, 90% to 73A17, 73% to 73A6, 61% to 73A8

CYP73A34    Hordeum vulgare (barley)
            Assembled from overlapping ESTs
            88% to 73A33, 87% to 73A7
BF620285.2 1-176 (no diffs) BE413007.1 49-282 (no diffs) BG367496 128-302 (no diffs)
AL504406.1 182-383 (no diffs) BE519761.2 245-401 (no diffs) BE412402.1 383-501 (no diffs)
MDVLLLEKALLGLFAAAVLAIAVAKLAGKRFRLP
PGPSGAPIVGNWLQVGDDLNHRNLMGLAKRFGEVFLLRMGVRNLVVVSSPELAKEVLHTQ
GVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMTVPFFTNKVVAQNRVGWEEEA
RLVVEDLRADPAAATKGVVVRRRLQLMMYNDMFRIMFDRRFETVADPLFNQLKALNA
ERSILSQSFDYNYGDF
IPVLRPFLRRYLNRCTNLKTKRMKVFEDHFVQQRKEALEKTGEIKCAMDHILEAERKGEI
NHDNVLYIVENINVAAIETTLWSIEWGLAELVNHPEIQQKLREEIVAVLGPGTPVTEPDL
ERLPYLQSVVKETLRLRMAIP
LLVPHMNLSDAKLAGYDIPAESKILVNAWFLANDPKRWVRADEFRPERFLEEERAVEANG
NDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQNFQLLPPLGKDKIDTTEKPGQFSNQI
RNHATVVCKPLKA*

CYP73A35P   Oryza sativa (rice) 
            GenEMBL AP003446.1 March 29, 2001
                    AP003302.1  Feb. 21, 2001
            Both sequences have the same frameshifts so
            This is probably a pseudogene

MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAA
LARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 (25 nuc. deletion and frameshift in both sequences)
175 RRRLQLMMYSNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF
LRGYLRICEEVKETRLKLFKDFFLEERK (1)
KLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVA (1)
AIETTLWSMEWAIAEL (2 nuc. insertion and frameshift in both seqs.)
VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNLRD
AELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNVEANGNDFRYLPSGA
GRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF*

CYP73A36    Citrus sinensis 
            GenEMBL AF255014.2
            Betz,C., McCollum,T.G. and Mayer,R.T.
            Differential expression of two cinnamate 4-hydroxylase 
            genes in Citrus
            Unpublished
            88% to 73A1

CYP73A37    Citrus paradisi (Marsh Grapefruit)
            GenEMBL AF378333.1
            Legrum,W., McCollum,T.G., Doostdar,H., Shatters,R. and Mayer,R.T.
            Cinnamate 4-hydroxylase in Marsh grapefruit flavedo
            Unpublished
            This sequence is 100% identical to 73A36 from aa 35 ITV to the end
            The N-terminal of 73A36 is conserved on other 73As but the 73A37 N-
            terminal is not conserved.  I suspect it is not processed correctly
            This may be the same gene as 73A36

CYP73A35P   rice
            aaaa01004255.1 $PI (indica ) ortholog of 73A35P

CYP73A38    rice
            aaaa01002376.1 $FI (indica ) ortholog to AQ256364.1 

CYP73A39    rice
            aaaa01006093.1a $FI CYP73 (indica ) 99% to AP004850.1b

CYP73A40    rice
            aaaa01006093.1b $FI CYP73 (indica ) 99% to AP004850.1a
            98% to AAAA01006093.1a 73A39

CYP73A41    Ammi majus L. , Apiaceae (Bishops weed)
            GenEMBL
            Silvia Huebner
            Submitted Jan 7, 2003
            Only 8 amino acid differences to CYP73A10 from Petroselinum crispum
            (parsley)

CYP73       Phaseolus vulgaris (kidney bean)
            PIR S34739 (23 amino acids)
            Rodgers, M.W., Zimmerlin, A., Werck-Reichhart, D. and Bolwell, G.P.
            Microsomally associated heme proteins from French bean:
            characterization of the cytochrome P450
            cinnamate-4-hydroxylase and two peroxidases.
            Arch. Biochem. Biophys. 304, 74-80 (1993)

74A Subfamily

Note on nomenclature of 74A sequences.  Historically, each species has had only one 74A gene described.
This was true up until 2000 when the tomato and Hordeum vulgare both had two 74A genes.  For simplicity in the 
Nomenclature, 74A sequences were not numbered sequentially, but they were just named 74A.  With the discovery of 
multiple 74As in tomato and Hordeum it became necessary to assign numbers to the sequences.  Once more, to keep the 
nomenclature simple, all sequences from species with only one 74A are named CYP74A1.  Those sequences that are from 
species with two 74As have a number assigned to distinguish them from 74A1.  

CYP74A1     Linum usitatissimum (flaxseed)
            GenEMBL U00428 (2038bp)
            Song,W.-C., Funk,C.D. and Brash,A,R.
            Molecular cloning of an allene oxide synthase: A cytochrome
            P450 specialized for the metabolism of fatty acid hydroperoxides.
            Proc. Natl. Acad. Sci. USA 90, 8519-8523 (1993)
            Note: This sequence has two exceptions to the P450 motif.

CYP74A1     Parthenium argentatum (guayule, a desert shrub)
            GenEMBL X78166 (1674bp)
            Pan,Z., Durst,F., Werck-Reichhart,D., Gardner,H.W., Camara,B.,
            Cornish,K. and Backhaus,R.A.
            The major protein of guayule rubber particles is a cytochrome
            P450: Characterization based on cDNA cloning and spectroscopic
            analysis of the solubilized enzyme and its reaction products
            J. Biol. Chem. 270, 8487-8494 (1995)

CYP74A1     Arabidopsis thaliana
            GenEMBL X92510 (1799bp)
            Laudert D., Pfannschmidt, U., Lottspeich, F., Hollanderczytko, H., and 
            Weiler, E.W.
            Cloning, molecular and functional characterization of Arabidopsis thaliana allene 
            oxide synthase (CYP-74), the first enzyme of the octadecanoid pathway to 
            jasmonates.
            J. Mol. Biol. 31, 323-335 (1996)
            Note: The EST N65720 matches this sequence closely, but not completely.

CYP74A1     Arabidopsis thaliana
            GenEMBL AB007647

CYP74A1     Arabidopsis thaliana
            GenEMBL Y12636
            Kubigsteltig,I.I., Laudert,D. and Weiler,E.W.
            Structure and regulation of the Arabidopsis thaliana allene oxide
            synthase gene
            Unpublished

CYP74A1    Arabidopsis thaliana
           GenEMBL AF172727
           Staswick,P.E.
           Sequence of an Allene Oxide Synthase cDNA from Arabidopsis thaliana
           (Accession No. AF172727). (PGR99-130)
           Plant Physiol. 121 (1), 312 (1999)

CYP74A1    Arabidopsis thaliana
           GenEMBL N65720(426bp)
           middle region starting about 234 amino acids in.

CYP74A1     Lycopersicon esculentum (tomato)
            GenEMBL AJ271093
            Sivasankar,S., Sheldrick,B. and Rothstein,S.J.
            Expression of allene oxide synthase determines defense-gene
            activation in tomato
            Unpublished
            64% to Arabidopsis 74A1, 70% to tomato 74A2

CYP74A1     Hordeum vulgare
            GenEMBL AJ250864
            Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
            Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
            tissue specific regulation in seedling development
            Plant J. 21 (2), 199-213 (2000)
            53% to Arabidopsis AOS, 89% to Hordeum 74A3

>CYP74A1    Nicotiana attenuata 
            GenEMBL AJ295274 16-NOV-2001 
            mRNA for allene oxide synthase (aos gene).

CYP74A1P1   Lupinus luteus (yellow lupine)
            GenEMBL Z49255 comp(1719-2132)
            possible pseudogene of CYP74A
            42% identical to 74A of guayule, nearly identical to 74AP2

CYP74A1P2   Lupinus luteus (yellow lupine)
            GenEMBL Z49255 comp(4284-4697)
            possible pseudogene of CYP74A
            42% identical to 74A of guayule
            BM74B

CYP74A2     Lycopersicon esculentum (tomato)
            GenEMBL AF230371
            Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
            Cytochrome P450-dependent metabolism of oxylipins in tomato.
            Cloning and expression of allene oxide synthase and fatty acid
            hydroperoxide lyase
            Plant Physiol. 123 (2), 711-724 (2000)
            63% to Arabidopsis 74A1, 70% to tomato 74A1

CYP74A3     Hordeum vulgare
            GenEMBL AJ250864
            Maucher,H., Hause,B., Feussner,I., Ziegler,J. and Wasternack,C.
            Allene oxide synthases of barley (Hordeum vulgare cv. Salome):
            tissue specific regulation in seedling development
            Plant J. 21 (2), 199-213 (2000)
            54% to Arabidopsis AOS, 89% to Hordeum 74A1

74B Subfamily

CYP74B1    Capsicum annuum (bell pepper)
           GenEMBL U51674 (1647bp)
           Matsui, K. Shibutani,M., Kajiwara,T. and Hase,T.
           fatty acid hydroperoxide lyase
           unpublished

CYP74B2     Arabidopsis thaliana
            GenEMBL Z97339 full length EST T20864 (367bp)
            Newman,T.
            unpublished (1994)
            N-terminal 121 amino acids, different from X92510 full length 74A sequence.

CYP74B2     Arabidopsis thaliana
            GenEMBL AF087932
            Bate,N.J., Sivasankar,S., Moxon,C., Riley,J.C.M., Thompson,J.E. and
            Rothstein,S.J.
            Molecular characterization of an arabidopsis gene encoding
            hydroperoxide lyase, a cytochrome P-450 that is wound inducible
            Plant Physiol. 117, 1393-1400 (1998)

CYP74B3v1     Lycopersicon esculentum (tomato)
            GenEMBL AJ239065
            Sheldrick,B.
            Thesis (1999) University of Guelph, Dept. of Molecular Biology and
            Genetics, Guelph, ON, Canada
            58% to 74B2
IPIMNPAPLSTPAPVTLPVRSIPGSYGLPLVGPIADRLDYFWFQ
KPENFFTKRMEKHKSTVFRTNVPPCFPFFGSVNPNVVAVLDVKSFSHLFDMEIVEKAN
VLVGDFMPSVVYTGDMRVCAYLDTSEPKHAQIKNFSQDILKRGSKTWVPTLLKELDTM
FTTFEADLSKSNTASLLPALQKFLFNFFSLTILGADPSVSPEIANSGYIFLDSWLAIQ
LAPTVSIGVLQPLEEILVHSFAYPFFLVKGNYEKLVQFVKNEAKEVLSRAQTEFQLTE
QEAIHNLWFILGFNAFGGFSIFLPTLLGNLGDEKNADMQEKLRKEVRDKVGVNPENLS
FESVKEMELVQSFVYETLRLSPPVPSQYARARKDFKLSSHDSVYEIKKGELLRGYQPL
VMKDPKVFDEPEKFVLERFTKEKGKELLNYLFWSNGPQTGRPTESNKQCAAKDMVTLT
ASLIVAYIFQKYDSVSFSSGSLTSVKKAS

CYP74B3v2     Lycopersicon esculentum (tomato)
            GenEMBL AF230372
            Howe,G.A., Lee,G.I., Itoh,A., Li,L. and DeRocher,A.E.
            Cytochrome P450-dependent metabolism of oxylipins in tomato.
            Cloning and expression of allene oxide synthase and fatty acid
            hydroperoxide lyase
            Plant Physiol. 123 (2), 711-724 (2000)
            4 amino acid diffs with 74B3v1

CYP74B4v1     Medicago sativa (alfalfa)
              GenEMBL AJ249245
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              63% identical to 74B2 61% to 74B1 and 74B3
              submitted to the nomenclature committee 8/23/99

CYP74B4v2     Medicago sativa (alfalfa)
              GenEMBL AJ249246
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              97.5% identical to v1
              the three forms show different activities
              submitted to the nomenclature committee 8/23/99

CYP74B4v3     Medicago sativa (alfalfa)
              GenEMBL AJ249246
              Noordermeer,M.A., van Dijken,A.J.H., Smeekens,S.C.M., Veldink,G.A.
              and Vliegenthart,J.F.G.
              Cloning and expression of alfalfa hydroperoxide lyase genes
              characterization of 13-hydroperoxide lyase isoenzymes with an
              unusual presequence and a proposal for a reaction mechanism                  
              99% identical to v1
              the three forms show different activities
              submitted to the nomenclature committee 8/23/99

CYP74B5      Psidium guajava (guava)
             No accession number
             Tijet N, Waspi U, Gaskin DJ, Hunziker P, Muller BL, Vulfson EN, 
             Slusarenko A, Brash AR, Whitehead IM.
             Purification, molecular cloning, and expression of the gene 
             encoding fatty acid 13-hydroperoxide
             lyase from guava fruit (Psidium guajava).
             Lipids. 2000 Jul;35(7):709-20.
             69% identical to CYP74B3
             submitted to nomenclature committee 4/14/00

CYP74B6P     Cucumis sativus (cucumber)
             GenEMBL AF229812
             Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
             Fatty acid hydroperoxide lyases in cucumber hypocotyls
             Unpublished

74C Subfamily

CYP74C1      Cucumis sativus (cucumber)
             GenEMBL AF229811
             Matsui,K., Wilkinson,J., Hiatt,B., Knauf,V. and Kajiwara,T.
             Fatty acid hydroperoxide lyases in cucumber hypocotyls
             Unpublished

CYP74C2      Cucumis melo (cantaloupe melon)
             GenEMBL AF081955
             Tijet N. et al (2001) Arch. Biochem. Biophys. 386, 281-289.
             a hydroperoxide lyase with specificity for both 9- and
             13-hydroperoxides of linoleic and linolenic acids

CYP74C3      Lycopersicon esculentum (tomato)
             No accession number
             Gregg Howe
             Submitted to nomenclature committee May 16, 2001
             57% to 74C1 58% to 74C2
             clone name LeAOS3

CYP74C4      Lycopersicon esculentum (tomato)
             No accession number
             Gregg Howe
             Submitted to nomenclature committee Nov. 28, 2001
             61% to 74C2 60% to 74C1 58% to 74C3

CYP74D1      Lycopersicon esculentum (tomato)
             GenEMBL AF317515
             Itoh A, Howe GA (2001) Molecular cloning of a divinyl ether synthase.
             Identification as a novel CYP74 cytochrome P450. J. Biol. Chem. 276: 3620-3627
             Submitted to nomenclature committee Aug. 28, 2000
             divinyl ether synthase (LeDES)
             54% to 74C4 50% to 74C2

CYP74D2      Solanum tuberosum (potato)
             GenEMBL AJ309541
             Stumpe,M., Kandzia,R., Goebel,C., Rosahl,S. and Feussner,I.
             A pathogen induced divinyl ether synthase (CYP74D)from potato
             suspension cultures
             Unpublished
             divinyl ether synthase (LeDES)
             96% identical to 74D1 51% to 74C2

75A Subfamily

CYP75A1     Petunia hybrida cv. Blue Star
            GenEMBL X71130 (1326bp) PIR S32110 (425 amino acids)
            Toguri,T., Azuma,M. and Ohtani, T.
            The cloning and characterization of a cDNA encoding a cytochrome P450 
            from the flowers of Petunia hybrida.
            Plant Sci. 94, 119-126 (1993)

CYP75A1     Petunia hybrida
            GenEMBL Z22544 (1740bp) PIR S33515 and S38984 (508 amino acids)
            Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D., 
            Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and       
            Cornish,E.C.
            Cloning and expression of cytochrome P450 genes controlling flower 
            colour
            Nature 366, 276-279 (1993)

CYP75A1     Petunia hybrida
            GenEMBL D14588 (1846bp)
            Ohbayashi,M., Shimada,Y. Nakano,R., Kiyokawa,S. and 
            Kikuchi,Y.
            unpublished (1994)
            flavanoid 3, 5' hydroxylase

CYP75A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X70824 (1696bp) Swiss P37120 (513 amino acids)
            PIR S43342 (513 amino acids)
            Toguri,T., Umemoto,N., Kobayashi,O. and Ohtani,T.
            Activation of anthocyanin synthesis genes by white light in eggplant 
            hypocotyl tissues, and identification of an inducible P-450 cDNA.
            Plant Molec. Biol. 23, 933-946 (1993)

CYP75A3     Petunia hybrida
            GenEMBL Z22545 (1923bp) PIR S33521 and S38985 (506 amino acids)
            Holton,T.A., Brugliera,F., Lester,D.R., Tanaka,Y., Hyland,C.D., 
            Menting,J.G.T., Lu,C.-Y., Farcy,E., Stevenson,T.W. and       
            Cornish,E.C.
            Cloning and expression of cytochrome P450 genes controlling flower
            colour
            Nature 366, 276-279 (1993)

CYP75A4     Gentiana triflora 
            GenEMBL D85184 (1666bp)
            Tonaka,Y. Yonekura,K., Fukuchi-Mizutani,M., Fukui,Y. Fujiwara,H.
            Ashikari,T. and Kusumi,T. 
            Molecular and biochemical characterization of three anthocyanin synthetic
            enzymes from Gentiana triflora
            Plant Cell Physiol. 37, 711-716 (1996)

CYP75A5     Eustoma grandiflorum (lisianthus)
            GenEMBL U72654 (2124bp)
            Nielsen, K.M. and Podivinsky,E.
            cDNA cloning and expression of a flavinoid 3'5' hydroxylase from petals
            of Lisianthus (Eustoma grandiflorum Grise)
            unpublished (1996)

CYP75A6     Campanula medium
            GenEMBL D14590 (1927bp)
            Ohbayashi,M.

CYP75A7     Eustoma russellianum
            GenEMBL D14589 (2174bp)
            Ohbayashi,M.

CYP75A8     Catharanthus roseus (Madagascar periwinkle)
            GenEMBL AJ011862 (1595bp)
            Kaltenbach,M., Schroeder,G., Schmelzer,E. Lutz,V. and Schroeder,J.
            Flavonoid hydroxylase from Catharanthus roseus: cDNA, heterologous
            expression, enzyme properties and cell type specific expression
            in plants.
            Plant J. 19, 183-193 (1999)

CYP75A9     Lycianthes rantonnei 
            GenEMBL AF313490
            Eder,C.M. and Forkmann,G.
            Lycianthes rantonnetii flavonoid 3',5'-hydroxylase
            Unpublished
            86% identical to 75A2

CYP75A10    Torrenia hybrida (cultivar:Summerwave Blue)
            GenEMBL AB012925
            Suzuki,K., Xue,H., Tanaka,Y., Fukui,Y., Fukuchi-Mizutani,M.,
            Murakami,Y., Katsumoto,Y., Tsuda,S. and Kusumi,T.
            Flower color modifications of Torenia hybrida by cosuppression of
            anthocyanin biosynthesis genes
            Mol. Breed. 6, 239-246 (2000)
            73% to CYP75A8

CYP75B1     Arabidopsis thaliana
            GenEMBL AL133421 and AB005249 at end of cosmid
            GenEMBL AF241643 exon 1, AF241644 exon 2, AF241645 exon 3, AF241646 exon 4,
            GenEMBL AF241647 exon 1 mutant

CYP75B2     Petunia hybrida
            GenEMBL AF155332 
            Brugliera, F., Barri-Rewell, G., Holton, T.A. and Mason, J.G.
            Isolation and Characterization of a flavonoid 3'-hydroxylase cDNA clone 
            corresponding to the Ht1 locus of Petunia hybrida. 
            The Plant Journal, 19, 441-451 1999 
            Florigene Ltd.
            clone OGR-38    (67% identical to 75B1 N-terminal exon)
            submitted to nomenclature committee 6/9/98

CYP75B3   Oryza sativa (rice)
          GenEMBl AC021892
          chromosome 10 clone 53D03 
          seq about 60% to 75B1 Missing part of N-term

61678 MDVVPLPLLLGSLAVSAAVWYLVYFLRGGTGANAARKRRPLPPGPRGXXXXGNL
PQLGXXXXXXXXXXXXXYGPLFRLRF 61442
XXXXXXXXXX
122805 APLAPSFLRGHDANF 122850 frame shift
122852 ATGPPNSGAEH
122885 VAYNYQDLVFAPTVALARLRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQQAA 123055
123056 SVALGQEANVCATNTLARATIGHRVFAVDGGEGAREFKEMVVELMQLAGVFNVGDFVPA 123232
123233 LRWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQPDGVAAGEHGNDLLSVLL 123394
123395 ARMQEEQKLDGDGEKITETDIKALLLNLF 123574
123575 TAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVGRGRLVSESDLPRLPYLTAVIKET 123754
123755 FRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIARDPTQWPDPLQYQPSRFLPG 123934
123935 RMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTATLVHGFDWTLANGATPDKLN 124114
124115 MEEAYGLTLQRAVPLMVQPVPRLLPSAYGV 124204

CYP75B4      Perilla frutescens var. crispa (Lamiaceae) (an Asiatic mint that produces oil seeds, Red Perilla, 
             beefsteak plant, chinese basil, purple mint)
             GenEMBL AB045593
             C. Kitada, M. Yamazaki, Y. Tanaka and K. Saito
             69% to 75B2
             Flavonoid 3'-hydroxylase
             clone name SHT12

CYP75B5     Callistephus chinensis 
            GenEMBL AF313489
            Eder,C.M. and Forkmann,G.
            Callistephus chinensis flavonoid 3',5'-hydroxylase
            Unpublished
            66% identical to CYP75B2

CYP75B6     Callistephus chinensis 
            GenEMBL AF313488
            Eder,C.M. and Forkmann,G.
            Callistephus chinensis putative flavonoid 3'-hydroxylase
            Unpublished
            73% identical to CYP75B5

CYP75B7    Matthiola incana 
           GenEMBL AF313491
           Eder,C.M. and Forkmann,G.
           Matthiola incana flavonoid 3'-hydroxylase
           Unpublished
           63% identical to 75B5

CYP75B8    Pelargonium x hortorum 
           GenEMBL AF315465
           Eder,C.M. and Forkmann,G.
           Sequence of flavonoid 3'-hydroxylase
           Unpublished
           64% identical to 75B5

CYP75B9    Gentiana triflora (gentian)
           No accession number
           Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
           flavonoid 3'-hydroxylase (F3'H)
           submitted to nomenclature committee March 21, 2001
           71% identical to CYP75B2

CYP75B10   Torenia hybrida (torenia hybrid)
           No accession number
           Yukiko Ueyama from Dr. Ohkawa's lab Kobe, Japan
           flavonoid 3'-hydroxylase (F3'H)
           submitted to nomenclature committee March 21, 2001
           67% identical to CYP75B2

76A Subfamily

CYP76A1     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71658 (1571bp) Swiss P37121 (467 amino acids)
            PIR S38535 (467 amino acids)
            Toguri,T., Kobayashi,O. and Umemoto,N.
            The cloning of eggplant seedling cDNAs encoding proteins from a
            novel cytochrome P450 family (CYP76)
            Biochim. Biophys Acta 1216, 165-169 (1993)
            Note: clone name F94 also called CYPEG8

CYP76A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71657 (1827bp) Swiss P37122 (505 amino acids)
            PIR S38534 (505 amino acids)
            Toguri,T., Kobayashi,O. and Umemoto,N.
            The cloning of eggplant seedling cDNAs encoding proteins from a
            novel cytochrome P450 family (CYP76)
            Biochim. Biophys Acta 1216, 165-169 (1993)
            Note: clone name G17 also called CYPEG7.

CYP76A3      Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 6/22/98
            clone IMT-4 64% identical to 76A2

CYP76A4      Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 6/22/98
            clone IMT-6 63% identical to 76A1 and 76A3

CYP76A5      Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 1/5/99
            clone IMT-9 66% identical to 76A1 and 76A2

CYP76A6      tomato
            GenEMBL ESTs only
AI779370  EST260249 cLES7J14
AI779369  EST260248 cLES7J14
AI488667  EST247006 cLED18N24
AI895030  EST264473 cLEC6H17
AI771692  EST252792 cLED34O18
AI774262  EST255457 cLER12I1 5 prime end = ARG10 homolog on reverse strand
AI779703  EST260582 cLES8J16
AI895857  EST265300 cLEC10E22
AI777873  EST258752 cLES3C24
AI777872  EST258751 cLES3C24
85% identical to 76A2
MEWELSYLFFSSIILLSIFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMA 
ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPA 
LARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRFVFLASFNMLG
NLILSKDLADPESEEASEFFHAMKGIMEWSGVANVSDVFPFLRKFDLQSLRKKMTRDMGK
AMEIMSMLLKERKKGMEKMKDFLDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTS
SSVEWALTELLRHPQAMAEVKTEISKAVGSNNKFEESDIENLPYMQAVIKESLRLHPPL
PFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPERFLGSKLDVKG
QHYELIPFGARRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSPKSINMDESMGVTA
RKRDSLKVIPKKV*

CYP76A7    Catharanthus roseus (Madagascar periwinkle)
             No accession number
             Joachim Schroeder
             54% identical to 76A4 and 76A5
             submitted to nomenclature committee Aug. 2, 2000 

76B Subfamily

CYP76B1     Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL Y09920 (1742bp) Y10098 (1685bp)
            Batard,Y., LeRet,M., Schalk,M., Zimmerlin,A., Durst,F. and
            Werck-Reichhart,D.
            Molecular cloning and functional expression in yeast of CYP76B1, a
            xenobiotic-inducible 7-ethoxycoumarin O-deethylase from Helianthus
            tuberosus.
            unpublished (1997)
            CYPYAN2

CYP76B2     petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee
            IMT-1

CYP76B3       Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone TF26
            submitted to nomenclature committee

CYP76B4     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A231
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)

>19 A231 76B4 Length: 509  July 30, 1997 Medicago sativa (alfalfa)
 
  1  MDMLQSSTLS YLVIIFTFSM LLLIKFLIPT NKTNQKNHSK LPPGPSPLPI
 51  IGNLLKLGNK PHHSLANLSN IHGPIMTLKL GQVTTIVISS ADIAKEVLQT
101  HDTLLSNRTV PDALSVLNHD QYSLSFMRVS PRWRDLRKIC NNQLFSNKTL
151  DSSQALRRRK LQDLLDDIKK CSEIDEAVDI GRVAFMTTIN LLSNTFFSAD
201  FVHSAEEAGE YKEIVVSILK EVGAPNLSDF FPMLTVFDLQ GIRRRSVVSV
251  KKVLSIFRRF VGERLKLREG TGSIENDDVL DALLNISLDD GKIEMDKDEI
301  EHLLLNIFVA GTDTTTYTLE WAMAELMHNP EIMSKVQKEL EQVVGKGIPI
351  QETDIAKLPY MQAVIKETFR LHPPVPLLLP RKAETDVEIG DYIIPKDAQV
401  LVNAWVIGRD PNKWDNANVF VPERFLDSEI DVKGHHFELI PFGSGRRICP
451  GLPLAIRMLP MMLGSLVNCF DWKLEDGLNI DDLNKEDEYG ITLEKSQPVR
501  IVPIKLTIQ

CYP76B5     petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 9/26/98
            IMT-7 56% identical to 76B1, 62% identical to 76B2

CYP76B6    Catharanthus roseus (Madagascar periwinkle)
           no accession number
           G. Collu, J. Memelink and R. Verpoorte
           submitted to nomenclature committee 1/14/99
           67% identical to 76B2, 66% to 76B5, 53% with 76B3 and 76B4,  
           61% with 76B1

CYP76B7    Pastinaca sativa (wild parsnip)
           No accession number
           Art Zangerl and May Berenbaum
           See webworms and parsnips website http://www.life.uiuc.edu/berenbaum
             40% to 76A7 54% to 76B1 58% to 76B2 50% to 76B3 50% to 76B4 57% to 76B5 61% to 76B6 
             48% to 76C2 42% to 76D1 48% to 76E1 49% to 76F1 54% to 76F2 38% to 76G1 43% to 76H1 
             and 76H2 53% to 76J1
           submitted to nomenclature committee 1/29/02

76C Subfamily

CYP76C1     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.9  Also D78600
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-4

CYP76C2     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.10
            ESTS H37250, T04013, T04014, T04015, T04016, T04017, Z33828, Z34697

CYP76C3     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.11
            no ESTs

CYP76C4     Arabidopsis thaliana
            GenEMBL AC003680 F17K2.8

CYP76C5     Arabidopsis thaliana
            GenEMBL AC010164 93429-96444
            clone F14M2

CYP76C6     Arabidopsis thaliana
            GenEMBL AC010164 comp(88950-90642)
            clone F14M2

CYP76C7    Arabidopsis thaliana
      No accession number yet
      clone T27I15 contig 5 from European Chr. 3 project 
      contains CYP76C7 and CYP76C8P

CYP76C8P    Arabidopsis thaliana
      No accession number yet
      clone T27I15 contig 5 from European Chr. 3 project 
      contains CYP76C7 and CYP76C8P

76D Subfamily

CYP76D1     Cicer arietinum (chickpea)
            GenEMBL AB032833 (1310 bp)
            Overkamp,S., Hein,F. and Barz,W.
            Cloning and characterization of elicitor induced cytochrome P450s
            from chickpea cell suspension cultures
            Unpublished (1999)

CYP76D1     Cicer arietinum   (chickpea)
            GenEMBL AB026263
            Ichinose,Y., Tiemann,K., Schwenger-Erger,C., Toyoda,K., Hein,F.,
            Hanselle,T. and Barz,W.
            Genes Expressed in Ascochyta rabiei-Inoculated-Chickpea Plants and
            Elicited Cell Cultures as Detected by Differential
            cDNA-Hybridization
            Unpublished (1999) internal fragment from C-helix on most like 76B (35%)

CYP76E1     Medicago sativa (alfalfa)
            no accession number
            Chris Steele
            clone A11
            submitted to nomenclature committee
            sequence below released directly from Chris Steele
            This sequence is not in Genbank (1/19/01)

>22 From Chris Steele (5/15/98) alfalfa 76E1 A11
searched nr 4/1/2000
MDHQTLLLVI TFVSATILIF FLRKSNQTQN STKLPPGPYP LPIIGNILEL
GKNPHKALTK LSKIYGPIMT LKLGSITTIV ISSPQVAKQV LHDNSQIFSN
RTVPHAITAV DHDKFSVGWV PTLNLWKKLR KNCATKVFST KMLDSTKILR
QQKLQELLDY VNEKSHNGEV FDIGETVFIN VLNSISNTLF SMDLAHSTPD
EKSQEFKTII WGIMEEAGKP NISDFFPILR PLDPQGLYAR MTNHMKKLCE
IFDGIIEERI CLKDSKGDYE VCNDVLDSLL NINIGEATSE LSRNEMVHLF
LDLFVAGIDT TSSMIEWIIA ELLRNPDKLT KVRKELCQTI GKGETIEESH
ISKLPFLQAV VKETFRLHPP IPLLLPHKCD ELVNILDFNV PKNAQVLVNV
WAMGRDPAIW DNPNTFVPER FMECDINYKG NNFELIPFGA GKRICPGLPL
AHRTMHLMVA SLLHNFEWNL ADGLIPEHLN MDEQFGLTLK RVQPLRVEAI
SSA

CYP76F1     Cicer arietinum
            GenEMBL AJ249799, AJ249802
            Stefan Overkamp and Wolfgang Barz
            submitted to nomenclature committee 9/27/99
            41% to 76A1, 46% to 76B1, 44% to 76C2, 46% to 76D1, 47% to 76E1
            This sequence is identical to CYP81D9.  Both are partial sequences
            One of the names needs to be retired.  
NSARVMTLKLGQVTTVVISSADMAKEVLLTHDLITSNRTVPDAL
SVLNHDQYSLSFMRVSPRWRDLRKICNYQLFSNKTLDSSQALRRRKLQDLLNDIERCS
KVGEAVDVGKAAFKTTVNLLSNTFFSVDFVHSAKEAGEYKEIIVSILKEVGVPNVSDF
FPMLKFLDLQGIRKRSIVSVKKVLSIFKRFVGERVKMREGTGSIGNDDVLDALLNMSS
DGGKIEMDKDEIEHLLLNIFVAGTDTTTYTLEWAMAELIHNPEMMSKLKEELEKTVGK
GIPVEETDIAKLPYMQAVIKETFRLHPPVPLLLPRRAEIDVKIGDYVIPKDAQILINA
WVVGRDPTKWENPNVFIPERFLDSEIDIKGHHFELIPFGSGRRTCPGLPLAIRMLPLM
LGSLVNCFDWKLEDGLNVEDFNKEDEFGITLEKSQPVRIVPTKLY

CYP76F2     Vitis vinifera (grape)
            GenEMBL AJ237995
            Davies,C. and Robinson,S.P.
            Differential screening indicates a dramatic change in mRNA 
            Profiles during grape berry ripening. Cloning and characterization 
            of cDNAs encoding putative cell wall and stress response proteins.
            Plant Physiol. 122, 803-812 (2000)
            mRNA for putative ripening-related P-450 enzyme (gfh2 gene)
            53% identical to CYP76F1

CYP76G1     Arabidopsis thaliana
            GenEMBL AL132966
            F08J02 from the EU Chr 3 project comp(64780-66639)

CYP76H1    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-12 prime
           Submitted to nomenclature committee 6/4/2001
           86% to 76H2 and 76H3

CYP76H2    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-11
           Submitted to nomenclature committee 6/4/2001
           95% to 76H3 

CYP76H3    Triticum aestivum (wheat)
           No accession number 
           Daniele Werck-Reichhart
           Clone name 76-17a
           Submitted to nomenclature committee 6/4/2001
           95% to 76H2, 36% to 76A6, 41% to 76B4, 45% to 76C2, 
           41% to 76D1 partial seq, 40% to 76E1, 46% to 76F2, 39% to 76G1

CYP76J1     Petunia
            no accession number
            Hiromasa Imaishi
            submitted to nomenclature committee 7/24/98
            clone IMT-8 

77A Subfamily

CYP77A1     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71656 (1683bp) Swiss P37123 (499 amino acids)
            PIR S41599 S40267 (499 amino acids)
            Toguri,T. and Tokugawa,K.
            Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
            belonging to a novel family (CYP77)
            FEBS Lett. 338, 290-294 (1994)
            Note: clone name H1

CYP77A2     Solanum melongena cv. Sinsadoharanasu (eggplant)
            GenEMBL X71655 (1673bp) Swiss P37124 (511 amino acids)
            PIR S41598 S40266 (511 amino acids)
            Toguri,T. and Tokugawa,K.
            Cloning of eggplant hypocotyl cDNAs encoding cytochrome P450
            belonging to a novel family (CYP77)
            FEBS Lett. 338, 290-294 (1994)
            Note: clone name H2

CYP77A3     Glycine max (soybean)
            GenEMBL AF022464 (1644bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 6/10

CYP77A4     Arabidopsis thaliana
            GenEMBL B97241
            GSS fragment BAC end T32M21TR
            note: contains N-terminal 65% identical to 77A3
            No ESTs

CYP77A5P    Arabidopsis thaliana
            GenEMBL AP000414 13981-14298 fragment
            65% identical to 77A2 with an in frame stop codon and 
            several frameshifts in the PERF to heme region
            identical match to EST H36337 clone 178A11T7
            opposite end = AA651240 clone 178A11XP 3', mRNA sequence
            matches AP00414 from 16129-16750 = 3 prime UTR

CYP77A6     Arabidopsis thaliana
            GenEMBL AC011560 71181-72725 clone F13M14 also on AC013428
            No introns

CYP77A7     Arabidopsis thaliana
            GenEMBL AC011560 72998-74939 clone F13M14 also on AC013428
            No introns

CYP77A8P    Arabidopsis thaliana
            GenEMBL AB010077 
            Pseudogene fragments
            51066-51110 (26-40), 56196-56252 (167-185), 
            56264-56377 (195-232), 75123-75146 (233-240)

CYP77B1     Arabidopsis thaliana
            GenEMBL AC007296 comp(89516-91048) 
            45% to 77A3 sequences no introns 
            ESTs Z30775, Z30776 noGSSs

78A Subfamily

CYP78A1     Zea mays (maize)
            GenEMBL L23209 (2087bp)
            Larkin,J.C.
            Isolation of a cytochrome P450 homologue preferentially expressed
            in developing inflorescences of Zea mays L
            Unpublished (1993)

CYP78A2      Phalaenopsis sp. hybrid SM9108 (moth orchid)
            GenEMBL U34744 (1799bp)
            Nadeau,J.A., Zhang,X., Li,J. and O'Neill,S.D.
            Molecular Characterization of Ovule Development: Isolation of
            Stage- and Tissue-specific cDNAs.
            unpublished (1995)

CYP78A3      Glycine max (soybean)
            GenEMBL AF022463 (1611bp)
            Siminszky,B., Dewey,R.E. and Corbin,F.T.
            clone name 6/4

CYP78A4     Pinus radiata (Monterey pine)
            GenEMBL AF049067
            Bishop-Hurley,S.L., Walter,C. and Gardner,R.C.
            Isolation and Expression of Abundant mRNAs during Somatic
            Embryogenesis of Pinus radiata
            Unpublished

CYP78A5    Arabidopsis
           GenEMBL AC027656 comp(32530-34190)
           Susan Carr Zondlo
           submitted to nomenclature committee Sept. 22, 1998
           58% identical to 78A2
           EST T45256

CYP78A6      Arabidopsis thaliana
           GenEMBL AC005819 AC006418
           65% identical to 78A3

CYP78A7      Arabidopsis thaliana
           GenEMBL AC016893
           59% identical to 78A4 and 78A1

CYP78A8     Arabidopsis thaliana
            GenEMBL AC007323 comp(15232-17051) 
            62% identical to 78A6 
            no ESTs no GSSs

CYP78A9     Arabidopsis thaliana
            GenEMBL AB036059
            Toshiro Ito
            submitted to nomenclature committee 9/9/99
            81% identical to 78A6
            EST AI995549 no GSSs

CYP78A9     Arabidopsis thaliana
            GenEMBL AB036059
            contig 31 of clone F21F14 from the EU chr 3 project 
            8955-10728 numbering will change as contigs are joined 
            (formerly confidential)

CYP78A9     Arabidopsis thaliana
            GenEMBL AL138642 (chr 3 F21F14)

CYP78A10    Arabidopsis thaliana
            GenEMBL AC016662

CYP78A11    Oryza sativa (rice)
            GenEMBL AC083943.6  25-JUL-2001
            clone OSJNBa0044A10, 61% to 78A7
            also submitted by Ahn Byoung-Ohg and N. Kurata 10/31/2001
40753 MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLAFATAAVLAWAASPGGPAWAHGRGRLGA 40965
40966 TPIEGPRGLPVFGSIFALSRGLPHRALDAMSRDAAAPRARELMAFSVGETPAVVSSCPAT 41145
41146 AREVLAHPSFADRPLKRSARELLFARAIGFAPSGEYWRLLRRIASTHLFSPRRVAAHEPG 41325
41326 RQADATAMLSAMAAEQSATGAVVLRPHLQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQ 41505
41506 LKSMVREGFELLGAFNWSDHLPWLAHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRD 41685
41686 SSSTAADNADFVDVLLSLEAHENLAEDDMVAVLW 41787 (phase 0 intron)
41874 EMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMP 42035
42036 YLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 42215
42216 EAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWF 42395
42396 LPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA* 42506



79A Subfamily

CYP79A1     Sorghum bicolor
            GenEMBL U32624 
            Koch, B.M., Sibbessen, O., Halkier, B.A., Svendsen, I. and Lindberg Moller, B.
            Arch. Biochem. Biophys. 323, 177-186 (1995)

CYP79A2      Arabidopsis thaliana (thale cress)
             GenEMBL AB010692 comp(11000-13200 region)
             about 53% identical to 79A1
             Note: this sequence was included in 79A when there was only one
             other CYP79A sequence.  Now that there are several, this sequence
             does not really fit well in the CYP79A subfamily.  However, the
             name will remain the same for historical reasons.

CYP79A3P     Arabidopsis thaliana
             GenEMBL AB025602 14755-16760 
             Stop codon in Heme signature and frameshifts at K-helix and after
             Heme signature. Probable pseudogene but alternative C-terminal lies beyond.
             88% identical to 79A2

CYP79A4P     Arabidopsis thaliana
             GenEMBL AB025602 22090-22536
             Lone C-terminal exon.  Note: this exon may join with N-terminal exons of 
             CYP79A3P to make a complete P450 gene.  The natural last exon my be skipped. 
             same as GSS B61504

CYP79A5     Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            58% to 79A1
            clone name 79A14
            submitted to nomenclature committee July 18, 2000 

CYP79A6     Triticum aestivum (wheat)
            No accession number
            Daniele Werck-Reichhart
            96% to 79A5
            clone name 79A1
            submitted to nomenclature committee July 18, 2000 

CYP79A7     Oryza sativa (rice)
            GenEMBL AC084319.5
               complement(join(117988..118644,121556..122530))
               also AC091302.3
               58% to 79A1
MSEAMAVTMPPMRAPALVAMLVVVLVALVRRRRHRSKGAGGRLESLPP
GPVGLPVIGNMHQMLVNKPVFRWVHRLLADAGGEIVCVRLGPVHVVAVTSPEMAREVL
RKNDAVFADRPTTFAAESFSVGYRSASISPHGDQWRKMRRVLTAEILSPATEHRLRGA
RGEEADHLVRYVLVRCGRDGAAVDVRHVARHFCGNVIRRLTLGRRHFREPRADDEDAA
APGRDEAEHVDALFATLNYLDAFCVSDYFPALVGLDLDGQEKVIKKVMRTLNRLHDPV
VEERVEEWRLLRKAGERRDVADFLDVLASLDDAAGRPLLTVEEIKAQTIDIMIATVDN
PSNAVEWALAEMMNKPEVMRKAMDELDTVVGRDRLVQESDVRDLNYLKACIREAFRLH
PYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYP
AGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGV
ERVELREEAASLVLAQPLVLQATPRLAAHLYGAGK

CYP79A8     Hordeum vulgare (barley)
            No accession number
            Soren Bak and Katrine Pontoppidan
            Submitted to nomenclature committee 4/9/02

CYP79A9     rice
            See rice pages

CYP79A10    rice
            See rice pages

CYP79A11    rice
            See rice pages

CYP79A12    Hordeum vulgare (barley)
            No accession number
            Kirsten Nielsen
            Submitted to nomenclature committee 5/21/03

79B Subfamily

CYP79B1     Sinapis alba (white mustard)
            GenEMBL AF069494 (1886 bp)
            Bak,S., Nielsen,H.L. and Halkier,B.A.
            The presence of CYP79 homologues in glucosinolate-producing plants
            shows evolutionary conservation of the enzymes in the conversion of
            amino acids to aldoximes in the biosynthesis of cyanogenic
            glucosides and glucosinolates.
            Plant Mol. Biol. 38, 725-734 (1998) 

CYP79B2     Arabidopsis thaliana (thale cress)
            GenEMBL AF069495 (1370 bp) AL035708 T5J17.120 complete sequence 
            Bak,S., Nielsen,H.L. and Halkier,B.A.
            The presence of CYP79 homologues in glucosinolate-producing plants
            shows evolutionary conservation of the enzymes in the conversion of
            amino acids to aldoximes in the biosynthesis of cyanogenic
            glucosides and glucosinolates.
            Plant Mol. Biol. 38, 725-734 (1998) 
            ESTs T42902 from C-helix on
            Contig 1510 of the TIGR Landsberg erecta sequences has 99% match

            Hull, A.K., Vij, R. and Celenza, J.L. (2000) 
            Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent 
            Indole-3-acetic acid biosynthesis.
            PNAS Early Edition (preprint)
            Converts trp to indole-3-acetic acetaldoxime (IAOx)

CYP79B3    Arabidopsis
            GenEMBL AC006592 comp(103303-105685) also AC007168 76873-79255
            85% identical to 79B2
            no ESTs no GSSs

            Hull, A.K., Vij, R. and Celenza, J.L. (2000) 
            Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent 
            Indole-3-acetic acid biosynthesis.
            PNAS Early Edition (preprint)
            Converts trp to indole-3-acetic acetaldoxime (IAOx)

CYP79B4P      Arabidopsis
            GenEMBL AC006592 comp(101836-101952) and comp(102489-102605)
            also AC007168 79953-80069 and 80606-80722 clone T26C19
            lone exons at C-terminal

CYP79B5     rape
            No accession number
            Barbara Halkier
            Submitted to nomenclature committee 6/7/00
       %identity (aa level) to other CYP79s is: 44.1 to E1, 44.1 to E2, 
       50.8 to D1, 51.4 to D2, 95.9 to B1, 93.5 to B2, 85.3 to B3, 
       52.0 to A1, 48.4 to A2, 38.4 to F1, 38.4 to F2, 41.0 to C1.

79C Subfamily

CYP79C1      Arabidopsis thaliana (thale cress)
            GenEMBL AC002986 comp(75-1680) AC007202 comp(77381-79610)
            C-terminal missing from AC002986.  Intron sequence after PKG runs off the end
            of the DNA on the complementary strand.  AC007202 complete
            Contig 505 and 1241 of the TIGR Landsberg erecta sequences have 100% matches

CYP79C2     Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 1899-4148
            this gene has four frameshifts in a preliminary version of the sequence.  It may be a    
            pseudogene there are three pseudogene fragments associated with it CYP79C3P, 
            CYP79C4P and CYP79C5P
            chromosome 1, 52% to 79C1

CYP79C3P    Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 5709-6541

CYP79C4P    Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 7210-7435

CYP79C5P    Arabidopsis thaliana (thale cress)
            GenEMBL AC008051 9049-9895

79D Subfamily

CYP79D1     Manihot esculenta (cassava)
            GenEMBL AF140613
            Mette Dahl Andersen
            submitted to nomenclature committee
            clone val152

CYP79D2     Manihot esculenta (cassava)
            GenEMBL AF140614
            Mette Dahl Andersen
            submitted to nomenclature committee
            clone val211

CYP79D3     Lotus japonicus
            No accession number
            Soren Bak
            submitted to nomenclature committee Feb. 7, 2003
            clone name sequence 1

CYP79D4     Lotus japonicus
            No accession number
            Soren Bak
            submitted to nomenclature committee Feb. 7, 2003
            clone name sequence 2

79E Subfamily

CYP79E1       Triglochin maritima
            GenEMBL AF140609
            Nielsen,J.S. and Moller,B.L.
            Cloning and expression of cytochrome P450 enzymes catalyzing the
            conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
            biosynthesis of cyanogenic glucosides in Triglochin maritima
            Plant Physiol. 122 (4), 1311-1321 (2000)
            clone tri 361

CYP79E2       Triglochin maritima
            GenEMBL AF140610
            Nielsen,J.S. and Moller,B.L.
            Cloning and expression of cytochrome P450 enzymes catalyzing the
            conversion of tyrosine to p-hydroxyphenylacetaldoxime in the
            biosynthesis of cyanogenic glucosides in Triglochin maritima
            Plant Physiol. 122 (4), 1311-1321 (2000)
            submitted to nomenclature committee 3/26/99
            95% identical to CYP79E1

CYP79F1     Arabidopsis thaliana
          GenEMBL AC006341 comp(63874-66127)
          46% identical to 79C1 less with other 79s
          ESTs F14189, F14190

CYP79F2     Arabidopsis thaliana
          GenEMBL AC006341 comp(60246-62290)
          89% identical to 79F1 no ESTs 98% identical to GSS B20058

80A Subfamily

CYP80A1       Berberis stolonifera
            GenEMBL U09610 
            Kraus.P.F.X. and Kutchan,T.M.
            Molecular cloning and heterologous expression of a cDNA encoding
            berbamunine synthase, a C-O phenol-coupling cytochrome P450
            from the higher plant Berberis stolonifera.      
            unpublished (1994)
            submitted to nomenclature committee

80B Subfamily

CYP80B1v1      Eschscholzia californica (California poppy)
            GenEMBL AF014800 (1901bp)
            Pauli,H.H. and Kutchan,T.M.
            Molecular cloning and functional heterologous expression of two
            alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
            new methyl jasmonate-inducible cytochrome P-450-dependent
            monooxygenase of benzylisoquinoline alkaloid biosynthesis
            Plant J. 13, 793-801 (1998)
            HP1
            41.8% identical to 80A1

CYP80B1v2      Eschscholzia californica (California poppy)
            GenEMBL AF014801 (1613bp)
            Pauli,H.H. and Kutchan,T.M.
            Molecular cloning and functional heterologous expression of two
            alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a
            new methyl jasmonate-inducible cytochrome P-450-dependent
            monooxygenase of benzylisoquinoline alkaloid biosynthesis
            Plant J. 13, 793-801 (1998)
            HP3
            99% identical to 80B1v1 possible allele

CYP80B2          Coptis japonica (Japanese goldthread)
           no accession number 
           Fumihiko Sato
           Submitted to nomenclature committee 3/21/99
           70% identical to CYP80B1
           clone name CYPCJA

CYP80B3    Papaver somniferum (opium poppy)
           GenEMBL AF191772
           Facchini,P.J. and Yu,M.
           cDNA cloning and characterization of (S)-N-methylcoclaurine
           3'-hydroxylase (CYP80B1) from elicitor-treated opium poppy cell
           suspension cultures
           Unpublished

81A Subfamily


Note: The 81 and 91 families have been joined due to new Arabidpsis sequences that have 
strong sequence identity to both families.  The CYP91 family sequences have been 
renamed with new CYP81 family names.  The old names will still be recognized, but the 
newer names will be preferred.

CYP81A1     Zea mays
            Sharon Potter
            sequence g 
            submitted to nomenclature committee

CYP81A2     Zea mays
            Sharon Potter
            sequence h
            submitted to nomenclature committee

CYP81A3     Zea mays
            Sharon Potter
            sequence i
            submitted to nomenclature committee

CYP81A4     Zea mays
            Sharon Potter
            sequence k
            submitted to nomenclature committee
            ESTs AI920363 (100% match) AI947634 (1 amino acid difference)

81B Subfamily

CYP81B1v1     Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL AJ000477
            Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
            Werck-Reichhart,D.
            Cloning, expression in yeast, and functional characterization of
            CYP81B1, a plant cytochrome P450 that catalyzes In-chain
            hydroxylation of fatty acids
            J. Biol. Chem. 273, 7260-7267 (1998)
            CYPYAN also called CYP81B1c

CYP81B1v2     Helianthus tuberosus (Jerusalem artichoke)
            GenEMBL AJ000478
            Cabello-Hurtado,F., Batard,Y., Salaun,J.P., Durst,F., Pinot,F. and
            Werck-Reichhart,D.
            Cloning, expression in yeast, and functional characterization of
            CYP81B1, a plant cytochrome P450 that catalyzes In-chain
            hydroxylation of fatty acids
            J. Biol. Chem. 273, 7260-7267 (1998)
            also called CYP81B1l

CYP81B2       tobacco
            no accession number 
            Yamada
            tobacco sequence 1
            submitted to nomenclature committee

CYP81B       Oryza sativa (rice)
           GenEMBL AF140486 partial sequence
           57% to 81B1v1 over C-terminal fragment

81C Subfamily

CYP81C1       tobacco
            no accession number 
            Yamada
            tobacco sequence 3
            submitted to nomenclature committee

CYP81C2       tobacco
            no accession number 
            Yamada
            tobacco sequence 4
            submitted to nomenclature committee

81D Subfamily

CYP81D1 formerly CYP91A1 (families joined)
            Arabidopsis thaliana
            D78606 (500 amino acids)
            Mizutani,M., Ward,E. and Ohta,D.
            Cytochrome p450 superfamily in Arabidopsis thaliana: isolation of
            cDNAs, differential expression, and RFLP mapping of multiple
            cytochromes P450
            Plant Mol. Biol. 37, 39-52 (1998)
            P450-65

CYP81D1     Arabidopsis thaliana 
            GenEMBL AB026661 comp(8484-10672)

CYP81D2     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.10 C-terminal fragment 
            AL035601 F6G17.10  complete sequence 
            GSS AQ250603

CYP81D2     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            complement(join(60895..61509,61614..62000,62132..62629))

CYP81D3     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.20
            Complete sequence 

CYP81D3     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            CDS complement(join(58723..59340,59438..59824,59979..60476))

CYP81D4     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.30
            Complete sequence 

CYP81D4     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            complement(join(56317..56919,56990..57364,57839..58339))

CYP81D5     Arabidopsis thaliana
            GenEMBL Z99707 C7A10.40
            Complete sequence

CYP81D5     Arabidopsis thaliana
            GenEMBL AL161591 possibly 9 genes
            CDS complement(join(53512..54114,54191..54574,54960..55460))
 
CYP81D6     Arabidopsis thaliana
            GenEMBL AC002391 T20D16.15
            Complete sequence 

CYP81D7        Arabidopsis thaliana
            GenEMBL AC002391 T20D16.18
            Complete sequence 

CYP81D8 formerly CYP91A3 (families joined)
            Arabidopsis thaliana
            GenEMBL AL035601 F6G17.20
            65% identical with 81D1
            ESTs AA586064, N38687, T41596, H76015

CYP81D8 formerly CYP91A3 (families joined)
            GenEMBL AL161591 possibly 9 genes
            complement(join(63742..64353,64451..64834,64952..65449))

CYP81D9X   Cicer arietinum (chickpea)
           GenEMBL AJ249802
           Stefan Overkamp
           submitted to nomenclature committee 4/28/99
           60% identical to 81D8 over J-helix to end of gene
           Note: 81D9 and 76F1 seem to be the same sequence
           One of the names must be discontinued.  This seq is partial
           And this reflects the difficulties of assigning a name to a partial 
           sequence.  The best match to 81D9 is a grape P450 AJ237995
           the grape seq seems to belong to the 76 family, so 76F1 is correct
           This is a problem I should have caught, but missed.
PPVEETDIAKLPYMQAVIKETFRLHPPVPLLLPRRAEIDVKIGD
YVIPKDAQILINAWVVGRDPTKWENPNVFIPERFLDSEIDIKGHHFELIPFGSGRRTC
PGLPLAIRMLPLMLGSLVNCFDWKLEDGLNVEDFNKEDEFGITLEKSQPVRIVQLNCI
ENMFRLLQFMRR

CYP81D10   Arabidopsis thaliana
           GenEMBL AC013288 14837-27604 clone T12I7
           74% to 81D2 chromosome I 
           GSSs B23310 B21261 no ESTs

CYP81D11   Arabidopsis thaliana
           GenEMBL AP002057 comp(8441-10208)
           chromosome 3, BAC clone T19N8, 67% to 81D2
           ESTs T14177 Z29010, Z29011, Z26103, H77232, F14118

81E Subfamily

CYP81E1 formerly CYP91A4 (families joined)
            Glycyrrhiza echinata_ L. (licorice; Fabaceae)
            GenEMBL AB001379  or D89431
            Akashi,T., Aoki,T., Kameya,N., Nakamura,I. and Ayabe,S.
            Two new cytochrome P450 cDNAs (Accession Nos. AB001379 and
            AB001380) from elicitor-induced licorice (Glycyrrhiza echinata L.)
            cells (PGR97-167)
            Plant Physiol. 115, 1288 (1997)            Ge-3
            50.1% identical to 81D1

            Akashi, T., Aoki, T. and Ayabe, S. 
            CYP81E1, a cytochrome P450 cDNA of licorice (Glycyrrhiza echinata L.)
            encodes isoflavone 2'-hydroxylase.
            Biochem. Biophys. Res. Commun. 251, 67-70 (1998)

CYP81E1v2      Glycyrrhiza echinata
            GenEMBL   AB022732
            Akashi,T., Aoki,T. and Ayabe,S.
            A cytochrome P450 cDNA from cultured Glycyrrhiza echinata L. cells
            unpublished (1999) In press
            CYP Ge-31 97% identical to CYP81E1
MDILSLLSYSVFYLALFFIFNIVIRARKFKNLPPGPPSLPIIGN
LHHLKRPLHRTFKGLSEKYGHVISLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRF
LSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLITRLA
DDSSTNFAEIELSYRFYDMTFNNIMRMISGKRYYGEDCDMSDLQEASQFRDMVSELLQ
LSGANNKTDFMPLLRFLDFENLEKRLKDISGKTDAFLRGLIQEHRAKKERANTMIDHL
LNLQDSQPEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVKDELDT
HVGQDRLVDESDLPKLSYLKNVINETLRLYTPAPLLLPHSTSDECNIGGYKVPQDTIV
LINAWAIHRDPELWTEATTFKPERFEKKGELEKLIAFGMGRRACPGEGLAIRAISMTL
ALLIQCFDWKLTNGDKIDMAERDGFTLTKLVPLKAMCKSRPVINKVFKQ

CYP81E2 formerly CYP91A5 
            Cicer arietinum (chickpea)
            GenEMBL AJ239051
            Overkamp,S., Hein,F. and Barz,W.
            Isolation of elicitor induced cytochrome P450 sequences from
            chickpea (Cicer arietinum) cell suspension cultures
            Unpublished
            submitted to nomenclature committee, sequence revised 5/20/99
            52.7% identical to CYP81E1

CYP81E3v1       Cicer arietinum (chickpea)
            GenEMBL AJ012581
            Stefan Overkamp and Wolfgang Barz
            Cloning of Two Cicer arietinum L.
            cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s 
            Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
            Plant Physiol. 120, 935 (1999)
            86% identical to CYP81E1 from licorice

CYP81E3v2       Cicer arietinum (chickpea)
            GenEMBL AJ238439
            Stefan Overkamp and Wolfgang Barz
            Cloning of Two Cicer arietinum L.
            cDNA's (Accession Nos. AJ012581 and AJ238439) Encoding Cytochrome P450s 
            Highly Homologous to Isoflavone 2'-Hydroxylase from Licorice. (PGR99-102)
            Plant Physiol. 120, 935 (1999)
            (revised sequence sent 4/28/99)
            85% identical to CYP81E1 from licorice
            96% identical to 81E3v1 (6 amino acid differences in N-terminal 20 amino acids)

CYP81E4     Cicer arietinum (chickpea)
            GenEMBL AJ249801
            Stefan Overkamp 
            62% identical to 81E1 from I-helix to end of gene
            84% identical to 81E5
            submitted to nomenclature committee 8/17/99 revised 9/6/99
IRHEIQAMLLAGTDTSAVTIEWVMSELLNHPDVLKQSKRRNRTQ
IGKDKLIEEHDLSKLPYLQNIINETLRLHPPAPLSLPHYSSEDFTLGGFNVPKDTIIL
TNVWAIHRDPKYWSDASSFKPERFEIDGELNKLIAFGLGRRACPGQSLAHRTVGLTLG
LLIQCFEWKRETEEKIDLREGKGLTMPMGVPLKAMCKPLPIANYIIS

CYP81E5         Cicer arietinum (chickpea)
            GenEMBL AJ249800
            Stefan Overkamp 
            submitted to nomenclature committee 9/16/99
            84% identical to 81E4

CYP81E6     Lotus japonicus
            GenEMBL AB025016
            Shimada,N., Aoki,T. and Ayabe,S.
            A cytochrome P450 cDNA from Lotus japonicus
            Unpublished April 4, 2000

CYP81E7     Medicago truncatula (barrel medic)
            No accession
            Chang-Jun Liu
            submitted to nomenclature committee 3/10/2003
            clon