Nov. 3, 1998
This set of 81 sequences has been compiled from genomic sequences, so the intron
exon boundaries may not be exactly correct.  In adding these sequences into my 
alignments before assigning names I did some additional editing, usually removing 
what seemed to be extra intronic sequences.  The sequences were compared to their most 
similar neighbors to identify differences in length and regions that were disimilar.  These 
areas were checked to see if an incorrect intron-exon boundary could account for the 
differences.  Be aware that these sequences are subject to my errors in judging intron-exon 
boundaries.  The GeneFinder program was helpful sometimes, but in many cases it did not 
find these gene's boundaries.

Note F40C5 and K07C6 are two different cosmids that map near each other but not at the 
same site and they both had the sequences CYP35A5, CYP35B1 and CYP35B2.  More recent examination of F40C5 shows that the current version does not have these P450s.

Official count at St. Louis is 85.9Mb/100Mb finished.  BLAST searchable C. elegans 
database at St. Louis is 146Mb, so 60Mb are present above and beyond the finished 
sequence.  The Blast searchable database at Sanger has 165.6Mb or 81 Mb above the 
finished sequence.  With only 14Mb left to finish, there is probably very little missing 
now, I think Y10C10 contig 57 contains the C-terminal of CYP33C2, but the intron 
sequences from contigs 57 and 60(33C2) do not overlap.

>T10B9.8   Z48717   CYP13A1 498 aa

MGYFWFPWFSAIFVAVFSYYIWQWTFWRRRGVVGPMGFPVLGVFLNSLD
NNPFPLQCREWTKKFGKIYGFTEGTLKTLVISDPELVHEVFVTQYDNFYGRKR
NPIQGDSEKEKRTNLFAAQGFRWKRLRAISSPTFSNSSLRKLYQTVEDSALELL
RHIEKQSAGGKQIDMLKFYQEFTLDVIGRIAMGQTDSQMFKNPNPIMPIVSKL
FQGNFAKLFLIGGIFPTFLVEIIRQILLKNLDAIHNRIKQREEDQKNGIEIGEPA
DFIDLFLDAKAEDVEHFGENNGDFSLTTEEIVGQCTVFLIAGFDTTALSLSYAT
YLLATHPEIQKKLQEEVNRECPNPEVTIDQLSKLKYMECVFKEALRLYPLGAF
ANSRRCMRNTKLGNMKVEVGTMIQVDTWTLHTDPNIWGDDAEDFKPERWQ
TPNSDQIYQKSGYIPFGLGPRQCIGMRLAYMEEKILLVHILRKFTFETGAKTEI
PLKLIGRATTQPESVWMHLNPRN*

>T10B9.7    Z48717    CYP13A2 495 aa

MSLGFVLAVTFSIFLGILTYYLWIWTYWMRKGVKGPRGRPFVGVLDVELLE
HETPGLIKLGEWTKKYGKVYGYTDGTQRTLVVADPAMVHEIFVKQFDNFYGR
KLNPIQGNPEKEQRVHLLAAQGYRWKRLRTISSQSFSNASLKKMKRTVEDSA
LELLRHIEKQTAGGEQIDMLRFYQEYTMDVIGRFAMGQTDSMMFKNPIVNV
VREIFCGSRKNLMLICQVFPPIGQFIRDLTFKFQDVVAARIAQREREKGAESGE
PQDFIDLFLDARSDDVDFSAEAREDFSLSADEVVGQCFLFLIGGFDTTALSLSY
VTYLLAVNPKIQEKVIEEIAREFGTSEVEFEKLGRLKYMDCVIKEALRLYPLA
SISNSRKCMKTTTVNGVKIEAGVYVQMDTWSLHYDPELWGEDVKEFKPERW
STDEPLEHKGAYLPFGLGPRQCIGMRLAIMEQKILLTHLLKNYTFETGNKTRIP
LKLVGSATTSPEDVFVHLRPRIW*

>T10B9.5   Z48717    CYP13A3 496 aa

MSLSILIAIALFIGVFTYYLWIWSFWMRKGIKGPRGLPFFGIINAFQSYEKP
WILRLGDWTKEYGPMYGFTDGVEKTLVVSDPEFVHEVFVKQFDNFYARKQN
PLQGDPDKDPRIHLVTSQGHRWKRLRTLASPTFSNKSLRKIFSTVEESVAEM
MRHLEKGTAGGKTIDILEYYQEFTMDIIGKIAMGQSGSMMFENPWLDKIRAI
FNTRGNIIFIICGIVPFTGSIFRWFFSKVPTATKRVEQRAADEKAGIESSGEPQD
FIDLFLDVQADTDFLEDETKNGFALTFDEIIGQLFVFLLAGYDTTALSLSYSSY
LLARHPEIQKKLQEEVDRECPDPEVTFDQLSKLKYMECVIKETLRLYPLASIVH
NRKCMKSTTVLGMKIEEGTNVQADTWTLHYDPKFWGENANEFKPERWESGD
EQAVAKGAYLPFGLGPRICIGMRLAYMEEKMLLAQILKKYSLETTFETHIPLK
LVGIATTAPTNVHLKLKPRHSD*

>T10B9.1   Z48717   CYP13A4 520aa

MSLSLLIAGALFIGFLTYYIWIWSFWIRKGVKGPRGFPFFGVILKFHDYENPGLLKL
GEWTKKYGSIYGITEGVEKTLVVSNPEFVHEVFVKQFDNFYGRKTNPIQGDPNKN
KRAHLVLAQGHRWKRLRTLASPTFSNKSLRKIMSTVEETVVELMRHLDEASAKG
KAVDLLDYYQEFTLDIIGRIAMGQTESLMFRNPMLPKVKEIFKKGGKMPFLIAGVF
PIAGTLMRQLFMKFPKFSPAFGIMNTMEKALNKRLEQRAADKKAGIEPSGEPQDFI
DLFLDARANVDFIEEESTLGFAKSEVLKVDKHLTFDEIIGQLFVFLLAGYDTTALSLS
YSSYLLATHPEIQKKLQEEVDRECPDPEVTFDQISKLKYMECVVKEALRMYPLASL
VHNRKCMKKTNVLGVEIDEGTNVQVDTWTLHYDPKVWGDDASEFKPERWETGD
ELFYAKGGYLPFGMGPRICIGMRLAMMEEKLLLTHILKKYTFDTSTETEIPLKLVG
SATIAPRNVMLKLTPRHSN

note: I had CYP13A4 as a duplicated 13A5 sequence.  This was a mistake.  The 13A4 sequence shown here is now correct.

>T10B9.2   Z48717    CYP13A5 496 aa

MSLSILIAGASFIGLLTYYIWIWSFWIRKGVKGPRGFPFFGVIHEFQDYENPG
LLKLGEWTKEYGPIYGITEGVEKTLIVSNPEFVHEVFVKQFDNFYGRKTNPIQG
DPNKNKRAHLVSAQGHRWKRLRTLSSPTFSNKNLRKIMSTVEETVVELMRH
LDDASAKGKAVDLLDYYQEFTLDIIGRIAMGQTESLMFRNPMLPKVKGIFKD
GRKLPFLVSGIFPIAGTMFREFFMRFPALNKRLEQRAADEKAGIEPSGEPQDFI
DLFLDARANVDFFEEESALGFALTFDEIIGQLFVFLLAGYDTTALSLSYSSYLL
ARHPEIQKKLQEEVDRECPNPEVTFDQISKLKYMECVVKEALRMYPLASIVH
NRKCMKETNVLGVQIEKGTNVQVDTWTLHYDPKVWGEDANEFRPERWESG
DELFYAKGGYLPFGMGPRICIGMRLAMMEKKMLLTHILKKYTFETSTQTEIPL
KLVGSATTAPRSVMLKLTPRHSN*

>T10B9.3    Z48717    CYP13A6 493 aa

MIFVLLSAVLLGVFTYSVWIWSYFIRKGIKGPRGFPGIGMLIQTIDHENPPFL
KYRDWTKQYGPVYGFTEGPQQTMIISEPEMVNEIFKKQFDNFYGRKLRPIIGDP
EKDKRVNIFSTQGKRWKRLRTLSSPSFSNNSLRKVRNSVQECGTEILWNIEQK
VRKNEDIDMLIVYQEYTLGVISRIALGQSESNMFKNPLLPKVQAIFNGSWHV
FLITGIFPPLAGVFRKMSKMLPAAVQARIDQRAKDEIKGVEPGEPQDFIDLFL
DARVPDVKILSGEANEDFLTFDEIIAQCFVFLAAGFDTTALSLSYATYLLATH
PEIQTKLQEEVDRECPDPEIFFDHLSKLKYLECVMKETLRLYPLGTTANTRKCM
RETTINGVNFDEGMNIQVDTWTLHHNPRIWGEDVEDFKPERWENGACEHLE
HNGSYIPFGSGPRQCIGMRLAQMEQKILLAQILKEYSFRTTKNTQIPVKLVGK
LTLSPESVIVKLEPRDS*

>T10B9.10    Z48717    CYP13A7 494 aa

MSFSILIAIAIFVGIISYYLWIWSFWIRKGVKGPRGLPFLGVIHKFTNYENPG
ALKFSEWTKKYGPVYGITEGVEKTLVISDPEFVHEVFVKQFDNFYGRKLTAIQ
GDPNKNKRVPLVAAQGHRWKRLRTLASPTFSNKSLRKIMGTVEESVTELVR
SLEKASAEGKTLDMLEYYQEFTMDIIGKMAMGQEKSLMFRNPMLDKVKTIFK
EGRNNVFMISGIFPFVGIALRNIFAKFPALNKRLEQREADEKAGIEPSGEPQDF
IDLFLDARSTVDFFEGEAEQDFALTFDEIIGQLFVFLLAGYDTTALSLSYSSYLL
ATHPEIQKKLQEEVDRECPDPEVTFDQLSKLKYLECVVKEALRLYPLASLVHN
RKCLKTTNVLGMEIEAGTNINVDTWSLHHDPKVWGDDVNEFKPERWESGDE
LFFAKGGYLPFGMGPRICIGMRLAMMEMKMLLTNILKNYTFETTPETVIPLK
LVGTATIAPSSVLLKLKSRF*

>T10B9.4    Z48717 (C-terminal)  CYP13A8  and Y53C12 whole 13A subfamily 510 aa

MIFELILISIVTYYFWHWTFWKRRGLPGPWGVPIFGKAGAMLEDSFPPGYT
LQKWTKEYGKIYGFTEGMQKVMVISDPDLVQEILVKQYDNFYGRKHNPVQGD
PDKDKDIHIVGAQG*FRWKRLRTITAPAFSNGSIKKVLTTMEDSTQELMKKLR
EESENGKAVNM*FSFYQEYTFDVISRVAMGQPDSQMFKNPLLKDVKGV*NKNVFL
QFFEHNRWQIWMFSGGFPFAVSFLKWLFIKVGKFGAGPFIVVQKSVTDAVMSRIA
QREADKKHGVEPGEAADYIDMFLNARAEVEHFGESNDEFHKLTTQEIISQCFV
FLVAGFDTTAISLSYVTYFLALNPKIQSKLQDEVDKECPNDEITFDQLSKLKYM
DNVIKESLRLFPFASFANSRRCMRNTVIGEQIVEAGVDVMIDTWTLHHDKN
VWGNDVEEFKPERWDSPLTPQQAYLSPFGAGPRVCLGMRFALLEQKGLLSHI
LKKYTFETNAKTQLPIKLVGRATARPENLFLSLKPRV*

>T10B9.6    Z48717    CYP13A9P 488 aa

MILTVLFFGILTYYLWIWHYWIRKGIRGPRGLPFFGVIHKFQNYDYPGYLKL
RDWTKKNGSVYGIXXXXXXTLIISNPEFVDEVFVKQFDNFYGRKQNPLQGDPN
KNPRVTLFSAEGHRWKRLXXLSSPTFSNKSLRIIMGTVEESVVEVMKYLEKE
VADGQHVNMLEYYQEYTLDVIGKIAMGQTESLLFKNPLMSGVKGVFQNKRK
YGSLVAGVFPIVGVLFRTLSMLEIVVCERLKQRKDDENNGFVKVGQPQDFIDL
FLDSRADLDFFEQEQTLEFTLTFDEIIGQLFVFFLAGYDTTALSLSYSSYLLATH
PEIQKKLQEEVDRECPDPEITFDQISKLRYMECVIKESLRMYPLATAAHNRKC
MKSINIRGVDIEKGTNVQVDTWSLHYDPKVWGDDANEFKPERWETGDELFY
AKGGYIPFGIGPRICIGMRLAMMEKKMLLVPVLKQYTFKTCSETEVPLKLVG
LSTIAPTSVILTLKPKMSRDQ*

>ZK1320.4    Z46934    CYP13A10 505 aa

MTQSLAHKNAWQCIFYLFLKAKYIYLSYYLWIWTYWRRRGIPGPLGYPLVG
SFPKTLKSEYPQYLQIRDWTKLYGPIYGYTEGTIKTLIVSDIDIVRQIFVEQYD
NFYGRKLNPIQGDPEKDERTNLFSAQGFRWKRLRAISSPTFSNNSLRKINVTV
EDSAMELLRHIEEQTSEGQQIDMLQFYQEFTMDTIGRIAMGQTDSQMFKNPLL
KFVRAIFGDNRKHIPLIGGVFPTLAQVFRFFMLKFVTAVQNRIDQRENDRKN
GIEIGEPQDFIDLFLEARADDVEHFQENNGDFSLTTQEIVGQCLVFLIAGFDTT
ALSLSYTTFLLATHPEVQKKLQEEIERECIEPSISFDHLSKLKYMDCIIKETLRL
YPLGTMANSRRCMRATKLGNVEVEVGTMVQVDTWSLHTDTKIWGDDAKEF
KPERWLDPNCDQVFQKGGYISFGLGPRQCVGMRLAYMEEKMLLAHILRKYTF
EVGTKTEIPLKLVGRATTQPETVWMHLKQRI*

>F14F7.2      Z81503    CYP13A11 517 aa also Y39E4 Z94158 102000-104000 region

MIILLFVVSSVVGIVSYYFWTWTYWRRCGIPGPQGYPFLGSALDMMDHENP
PFLQLKKWTSQYGKVYGITEGLLRTLVISDTNLIHEVFVKQYDNFYGRNLNPI
QGDPNREKRVTLFSAQGHRWKRLRTIANPTFSSNNLRKIQVTVEDSALELLR
HIEQHTAGGKAIDVLEYFQEFTMDVIGRIAMGQPDSLMFKNPLLPCARDVFG
KPRTALFLSGILFPWIGPMIRKVVFYFTNVFNNPAAQIMYQTANAVEQRIK
QRMAEEKAGIDPGEPQDFIDLFLDAKSDDMELENNEDFTKAGVKVTRQLTKDE
VVGQCFVFLIAGFDTTALSLSYSSFLLATHPKAQKKLQEEIDRECADPEVTFDQ
LSKLKYMECVIKETLRMYPLGALANSRRCMRSTKIGNYEIEKGVDILCDTWT
LHYDKSIWGEDAEEFKPERWESGDEHFYQKGGYIPFGLGPRQCIGMRLAYMEE
KLLLSHILRKYTLEVCNKTQIPLKLIGSRTTQPESVWLNLTPRDDN*

>F14F7.3     Z81503    CYP13A12 518 aa also Y39E4 Z94158 105000-108000 region

MAIIFLAILTSIIGVLSFYLWTWSYWKRRGIAGPSGYPILGSALEMLSSENP
PYLQLKEWTKQYGKVYGITEGLSRTLVISDPDLVQEVFVKQYDNFFGRKLNPI
QGDPNKDKRVNLFSSQGHRWKRLRTISSPTFSNNSLRKLKTTVEECAVELLRH
IEQHTDGGQPIDLLDFYQEFTLDVIGRIAMGQTDSQMFKNPLLPYVRAVFGEP
RKGLFLSGSLAPWIGPILRMVMFSLPNIVKNPAVHVIRHTSNAVEQRVKLR
MADEKAGIDPGEPQDFIDLFLDAKSDDVELENNEDFTKAGVKVTRQLTTEEIV
GQCFVFLIAGFDTTALSLSYSSFLLATHPKVQKKLQEEIDRECADPEVTFDQLS
KLKYMECVIKETLRMYPLGALANSRCCMRATKIGNYEIDEGTNILCDTWTLH
SDKSIWGEDAEEFKPERWESGDEHFYQKGGYIPFGLGPRQCIGMRLAYMEEKL
LLSHILRKYTLEVCNKTQIPLKLIGSRTTQPESVWLNLTPRDDN*

>F02C12.5   Z54269  (C-terminal)  CYP13B1  C29F7 Z92827 N-terminal 511 aa

MGAIIVLVVLFATIAGYFKWIHTYWRRRGISGPEGLPFIGNYYDLADVNKPRGYLI
HKWTQV*FGKVFGYYEGAVPVLVVSDMDMLQELFLKKFDNFYARKSTNHIHGNL
ECSKSEPRINLFTSRGARWKRLRALASPGFSVKALKQVY*VHDVMEDSAINMVDL
MAKHEDGKPFNIH*RYFQEFTYDVISRLAMGQPNSELFNNSGVEIVK*IFMRTHRV
LPWYFTVLFPQFEHLVKRMFYNHAAVQGGDIEKLLLICKKTVESRIQER*ENAKLG
FENAENDFIDMFLNYYSEQVEDIEFGSTVEKKVTAEDVIGACFVFLLAGFDTTANSL
AYASYLLAKHPEKMKLAQEEVDTVVGSENVSYDDMTKLKYLDAVVRESLRLYPVA
WFACSRECVKPTTLGDIYIDKGVKIEADVMSLHRSKEIWGENADDFVPERWLEPSS
RHTMSWIPFGAGPRQCVGMRLGLSEAKTALAHLLRRYDLVAGVETEKELNILGCT
TTSPEAVTLYLKPRI*

>K06G5    Z81565      CYP13B2 511 aa

MGVIVCLVAIIGVVAGYFKWIHSYWKRRGIEGPVGLPFIGSFYDLADREKPRGFIIN
KWTKXFGKVFGYYEGVIPVLVVSDLDMLQEMFIKKFDCFYARKTTNLIHGNLECS
QEEPRVNLFAARGARWKRLRALASPAFSVKALKQIHETMEDSVFSMVDHMSKQV
NGEAFNIHEYYQEFTYDVISRLAMGQTYSEQFNNEGVDIVKKIFLRKNRVYPWYLA
VMFPGFENTIKNTFFNHEAVRGGDVGKLLKFCETAVHDRLKER*ADNVEQGIENP
HNDFIDMFLDYYTDTNIEDNAFGIKVEKKVTSEDVIGACFVFLLAGFDTTANTLAY
ASYLLAKHPQEMRKVQDEIDRICTSEHISYDDIGKLRYMDAVIREALRMYPVAWFA
CSRECVQATTLGNYYIEKGVRIEADVRALHYSEEIWGKNANEFVPERWLESSPRH
NMSWIPFGAGPRQCVGMRLGLSEAKTALAHLLRRFSILAGPKTEKELHLQGCTTT
SPEKVTVHLMTRD*

>K09A11.2    Z50742   CYP14A1 491 aa

MSVFILAFVIFIIFYVFHFYWKVSKYPKGPLPLPFIGNIHQFPPDNVQKYFDVLSKT
YGPCFTIWIPFPAIVLTDYEHIKDAFVNQGDTFTYRAHRSPETLLPVHDHTGILASD
GDHWRLQRRTSLKILRDFGLGRNLMEEQVIRSVHEMLIQLENINDKKNVDVFWPI
QLCVGNVINETLFGFHYKYEDSEKFKTFVKIVDKHLRHLQGKMPLLVSAFPWLKH
VPIVGDIGYHNIKNNISSYHTFIEEEVATQVKKYDGESEPENFVHAYMQQMKQTGN
PGLDITNLCATVLDFWLAGMETTSNSLRWHLAFMMKYPEVQDKVRKEILDNVGT
ARLPSMSDKPNMPYTQAVIHEVQRCSNMIPFLGSHQCKEETEIHGNRVPAGSLVFA
QLWSVMRNDTVFEDPETFNPSRYLQSDGKTFDKAVLEKTIPFSIGKRNCVGEGLA
RMELFLIFSALIQKYEFVATSNIDLTPDWGVVLTAKPYTCNIIPQF*

>K09A11.3    Z50742   CYP14A2 491 aa

MSILIVAFVSITVYIAYFYWKVSKYPKGPFPLPFIGNILQIPSENIQEYLDDLSKTYGP
CFTLWTPLPAIVLTDYEHVKEAFVTQGDAFIYRADRPPETLLQPHLNTGVLFSNGD
NWRFQRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLERIADKKNVDMFWPIQ
LCVGNVINESLFSYHYKYEDSKKFETFVKVLDKHLKTVQGKTIFLMSAFPWLKHF
PVIGELGYHRIKKNIQSYQEFINDEVTSQIKHYDGESEPENFVHAYMQQMKQSGNP
NLDMNNLCASVLDFWLAGMETTSNSLRWHLAAMMKYPEIQDKVRKEIFDNVGTA
RLPSMSDKPNMPYTQAVIHEVQRCSNMIPILGTHTNRDDILLKGKKIPTGTLVFAQI
WSVLKNDPVFEESSKFNPDRYLMADGKTINKSVLERTIPFSVGKRNCVGEGLARM
ELFLIFSALIQKYEFIPKTNIDVKPVCGAVLTTKPYICELVPQAA*

>K09A11.4    Z50742   CYP14A3 498 aa

MSVFIIAFFTFITTYVAYFYWKVSKYPKGPLPLPFFGNLLQFPAENIHLYFDELSQTY
GPCFTLWTPLPAVVLTDYDHVKEAFVTQGDAFINRANRPPETLLQPHLNTGVLGSS
GDNWRLQRRTALKILRDFGLGRNLMEEQVMRSVQEMLAQLDHIPDKQNVDMYWP
IQLCVGNVINESLFGYHYKYEDSDKFETFVKVINKHLKIAQGKPQLLVSAFPWLRY
VPIIGELGYHKIQRNIQSYQKFIDEEVVSQIKQYDGESEPENFVHAYLQQMKQSGNP
NLDMNNLCASVLDFWLAGMETTSNSLRWHLAAMMKYPEIQDKVRKEIFDNVGTA
RLPSMSDKPNMPYTQAVIHEVQRFSNMIPILGTHTNKEDILLKGKNVPTGTVIFAQI
WSVLKNDSVFEDSHKFNPDRYLLTDGKTFDKTILERTIPFSVGKRNCVGEGLARM
ELFLIFTALIQKYEFIPNGSIDLSPVPGAVLTTKPYTCRLIPQSARKFQLF*

>K09A11    Z50742   end of cosmid = R04D3.1  Z70212   CYP14A4 486 aa

MSPLLILAFFVATVGYLVHFYLKVRKYPKGPFPLPVIGNLHQIPGGNLEIWFDELA
KIYGPCYTVWSPLPCVVLTDFDHIKNAFVTQGEFNNRAHKPPESLLHVHDNTGIL
NSSGENWQLQRRTSLKILRDFGMGKNLMEEQIVKSVQEMMTQLEKTDDKKKADI
FWPVQLCVGNVINQVLFGYHFKYDDCERFQKFVSVIDFHLRTLLGKCSLLVSAFP
MLRHVPIIGEYGYQRIKRNIKSYQYFIEEEVATQMKSFEEENEPENFVHAYMQQMK
QNGHPGLDVKNLRACALDFWLAGMETTSNSLRWHIAYMMKHPDIQDKVRKEILD
VVGNSRFPSMSDKPNMPYTQAVIHEVQRHSNMVPFLGTHSGNKDTNVLGQNIPA
GTNVLVQAWSVMRNDPIFFNPDRYLMADGKSFDKNILEKTIPFSVGKRSCIGEGL
ARMELFLIFSALIQKYEFIANGPVDMSYDFGAVLTIKPYTCQLKAQF*

>F09F3.7     CYP14A5 492 aa

MSVFIVALSVFIISYVISFYWKVRKYPKGPFPLPFFGNLLQFPADNIQEHLDK
LSKTYGPCFTVWTPLPAVVLTDYEHIKEAFVTQGDAFVNRAQRLPEILFQPH
PNTGVVFSSGDNWKIQRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLEH
ISDKKNVDMYWPIQLCVGNVINESLFGYHYKYEDAGRFEKFVKVVDRHLKIA
QGNASLLVSAFPWLRHLPVIGNLGYHSIKNNIKSYQQFIEEEVTSQLKNYDGE
SEPENFVHAYMQQMKQTGNPNLDMTNLCASVLDFWLAGMETASNSLRWH
LAFMMKYPEVQDKVRNEIFENIGTARLPSMSDKQNMPYTQAVIHEVQRCSN
MVPILATHMNTEDVLVKEHNIPTGTLLFAQIWSVLKNDPVFEENSKFNPDR
YLMPDGKTLNKTVLERTIPFSVGKRNCVGEGLARMELFLIFSALIQKYEFIPK
TNVDLKPVYGGVITVKPYLCELVPQNA*

>T13C5.1   U39648   CYP22 527 aa too long

SSWIKCRDWMAFALSHHIIMGIYLLILRNFLPQVVPDFEWQHYFMRVFIVHIIYIIIS
YFIRITRYPPGPPPMAVFGNSPFVNILTPEQTFLEYREIYGPIFTLHLSQPTIILAEYKT
IQEALVKNGQQTSGRSSAESFVLFTGDRLNGDGVILAMRQKWKDMRHEISRFMN
KWYGAPMDELVLHHTRCLEQELAKIAETKSLIDLRDPLAGAIANVIQQITIGRNYMY
QDQEFQTQLRDINAVVKEIMTAEVFFVNCYPWLRYLPEGILRKWTNYKRSGFRLQ
QWFRTILEEHHVNRHQGDFMSHMIDLQESKQEQFRDLSIILTCGDMWTGGMETTV
TTLRWGIIYLLNNPEVQAKCQMEILDVFGNDIPDMGKMNQTPYVRATLSEIQRLAN
VLPWAIPHKTIEECNIGGYDIPVNTEIIPALGAVLFDPNVFESPKQFKPERFLDEEGK
YRVMEEFRPFGLGPRVCLGERIARTELYLIFASLLQNFRFYLNRGDPIPVAERVIGGI
KPYATRVEYLGNRLIN*

>B0304.3    U39472   CYP23 538 aa

MPIAYFLPSQVNSGVCCLICRHWYLIGQATYIYFLTCITLYAIYELNYKRRRL
PNGPVPWLVAGNMPSFINVNNVDVLFQSWKQQYGGIFTVWIGPIPLVMVS
DLPTIKKYFIQHADSFSNRWRNFVTDSIMEGSNGIVQIDGNKWREQRRFALHT
LRDFGVGKPLMEQMITLEVTSLMNHMEKSCGLDGKELHLCPSIAVCVGNIIN
NMLFGLRFNQDNSYMHRLHQLLDDQSHTVMQPIMGAYIAFPVTSKIPIINGE
WNRLMGIKNELLEFLETQIEGHRMNWKDEMIEQEPEDLTYAYMIEVEKRKRN
GFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAELDSIG
QPMIEIQHRTRLPYVQATINEIQRIANILPINLLRTVAEDIEIDGYNFKKGDLII
PQISILMNDPEIFENPEEFNPSRFLDEDNNVKKIDEFLPFSIGRRQCLGESLARA
ELYLVFANLIQNFNFEVAVTTEVCLKLGNPNFSTRIFKFKIFYSFTRLGTFKKM
YFLGYCRRTVG*

>C36A4.1    Z66495   CYP25A1 496 aa corrected 9/14/98

MALLILSSLVISIFTFFIYIILARRERFKLREKIGLSGPEPHWFLGNLKQTAERK
DANRWFNELHEQYGETFGIYYGSQMNIVISNEKDIKEVFIKNFSNFSDRSVPSI
YEANQLTASLLMNSYSSGWKHTRSAIAPIFSTGKMKAMQETINSKVDLFLDI
LREKASSGQKWDIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDVFY
VNAKKYISNIDIRHSKIIAASVLLPELSTFWKALYKYTPLADAEIPLVEGLSNV
YERRRGGEGSDSVDLLKLLLNREDDKSKPMTKQEVIENCFAFLLAGYETTSTA
MTYCSYLLSKYPNVQQKLYEEIMEAKENGGLTYDSIHNMKYLDCVYKETLRFY
PPHFSFIRRLCREDITIRGQFYPKGAIVVCLPHTVHRNPENWDSPEEFHPERFE
NWEEKSSSLKWIPFGVGPRYCVGMRFAEMEFKTTIVKLLDTFELKQFEGEAD
LIPDCNGVIMRPNDPVRLHLKPRN*

>C36A4.2    Z66495   CYP25A2 496 aa

MALLILTSILILLVSFIIYILFARREQFKLREKIGLTGPEPHWFMGNLKQIVDR
KDSNKWFNELHKQYGETFGIYFGAQMNIVLSNEEDIKEVFIKNFSNFSDRIVPP
IFDSNQLNQSLLQNTYATGWKHTRSAIAPIFSTGKMKAMQETIHSKVDLFLD
ILREKASSGQKWDIYEDFQGLTLDVIGKCAFAIDSNCQRDRNDVFYVNARKFI
ANIDIRHSKVIAASFILPELAPLWRALYKYTPLADAEIPLVEGLSNVYERRR
GGEGSDSVDLLKLLLNREDDKSKPMTKQEVIENCFAFLLAGYETTSTAMTYCS
YLLSKYPNVQQKLYEEIMEAKENGGLTYDSIHNMKYLDYVYKETLRCYPPVIH
FINRRCLADITIRGQFYPKGSVVTCLPHTVHLNPENWDSPEEFHPERFENWEE
KSSSLKWIPFGVGPRYCVGMRFAEMEFKTTIVKLLDTFELKQFKGEADLIPDC
NGVIMRPKDPVRLLLKPRN*

>C36A4.3    Z66495   CYP25A3 496 aa

MAFLILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIER
KDSYDWYNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPI
IEDNKLKESLLQNTYESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEIL
KEKASSGQKWDIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDVFYVNARKFITN
IDIRHSKIISTSFLFPELSKLWKVLYRFTDLAKAEIPLVEGLADVYERRRGGEG
SDSVDLLKLLLNREDDKSKPMTKQEVIENCFAFLLAGYETTSTAMTYCSYLLS
KYPNVQQKLYEEIMEAKENGGLTYDSIHNMKYLDYVYKETLRCYPPVIHFSNR
RCLKDITIRGQFYPKGAIVVCLPHTVHRNPENWDSPEEFHPERFENWEEKSSSLK
WIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFELKQFEGEADLIPDCNGVIMRPKD
PVRLHLKPRN*

>C36A4.6    Z66495   CYP25A4 495 aa

MAILIISTIFFTIITFISYSIWRRHAIFKLRSSIGIPGPPVHWLWGNLNIIKDR
VDTTQWHPTLHTKYGPIFGLYCGTQLHITVSEEEDIKEIFIQNFSNFSDRMTPD
IFGMNQLNQSLLQNTYATGWKHTRSAIAPIFSTGKMKAMHETLVSKIDIFLE
VLKEKSSSGQKWDIFENFQSLSLDIIGKCAFAIDSNCQRDRTDLFYVQARKFVG
AVDLKKSWILPVSLILPELSWLWRFLYKFSDLSAAELPLVKGLVDLYDRRR
AGEGGNDSTDLLNLLIRRETIGKMTQREVIENCFAFLIAGYETTSTAMMFSAY
LLAEYPIVQQKLYEEIKKTKENAGLYNDSIHNMKYLDCVYKESLRFYPPTTHF
TNRVCLNDMTIRGQIYPEDSTLKVQPYTIHRNPANWESPDEFQPERFENWEEK
SSSLKWIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFELSLVPGDPPMIPET
NGVIFRPRSPVRLNLKLRI*

>F42A6    CYP25A5 495 aa

MAILIISTIFFTIITFISYIIWRRHSIFKLRSSIGIPGPPVNWLXGNLNIIKEWG
DTTQWHPTLHTKYGPIFGLYCGTQLHITVSEEEDIKEIFIQNFSNFSDRMTPNIF
GMNRLNQSLLQNTYATGWKHTRSAVAPIFSTGKMKAMHETLVSKIDIFLEV
LKEKSSSGQKWDIFSNFQSLSLDIIGKCAFAIDSNCQRDRIDLFYVQARKFVGA
VALKKSWILPVSVILPELSWLWRFLYKFSDLSAAELPLVKGLVDLYDRRRA
GEGGNDSTDLLNLLIRRETIGKMTKREVIENCFAFLIAGYETTSTAMMFSAYL
LAEYPIVQQKLYEEIKKTKESAGLNYDSIHNMKYSDCVYKESLRFYPPTTEFTN
RVCLNDMTIQGQIYPKDSTLKVQPHTIHRNPANWESPDEFQPERFENWEEKSS
SLKWIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFELSLVPGDPPMIPETNG
VIFRPRCPVRLNLKLRI*

>K06B9.1    PSEUDOGENE      CYP25A6P 250 aa

MAFLILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIER
KAKLGYDDSYDWYNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFS
DRTPPPIIEDNKLKESLLQNTYESGWKHTRSAIAPIFSTGKMKAMHETIHSKV
DLFLEILKEKASSGQKWDIYELVQKLLNDSDIYYFSDFQGLTLDVIGKCAFAID
SNCQRDRNDIFYVNARKFITNIDIRHRQNFKKGSQ*

>C44C10.2    Z69787   CYP29A1 502 aa also Y102F5 AL022276 61000-63000 region

MALILIIILICLLSFKPWSWKTIQLIXKYRQYDDKIPGPPTHPIFGNTETFKNKSQTEI
TEIFRQTADETRSQGKSVMKYHILGKLYVWPLDGKTIAKLVESTTELNKGDDYNFF
LPWLGGGVLVEGFGERWRTHRKLLTPTFHFAKLEGYLEVFYSETKIMIEHLEKFA
DNEETVDMFPYIKRCALDIICGAAIGTKINAQMHHNHPYVKAVEGFNSMAISHAIN
PSYQIPAIYWALGLKKQKDAHLNTMKTFTVNVIADRKAAIASGEVEKETSKRKMN
FLDILLNSEESNSLTSEDIRQEVDTFMFAGHDTTTTSVSWACWNLAHNPDIQEKVY
EEIVHIFGEEPNDEVTSEGISXLEYTERVLNESKRIIAPVPSLQRKLINDMEFGGMTIP
SGANVSIAPLALHSNAQVFPNPNKFDPDRFLPDEIAKRNAYDFMPFSAGLRNCIGE
KFALLNEKVMMIHILKNFRLEPMGGFYSTKPMFEAVARPSNGISVKLIRRQF*

>T19B10.1    Z74043    CYP29A2 503 aa

MTIFIPISIAIILAYLATWIPTLLKYKRHWQYGSKLPGPPAHPIFGNLGPIVGKKTED
LPSVFINWAAEQRDQGHSVMRVMILGKVYAWPLNGKAAAAIIDSTTETNKGDDYR
FFDPWLGGGLLLEGYGERWKSHRKMLTPAFHFAKLGGYFEVFNNESKILIDLLSD
FSASGETVDIFPYVKRCALDIISETAMGIKIDAQINHDHKYVQAVEGYNKIGVLVSF
NPHLKNQFIFWATGYKAQYDDYLSTLKSMTEKVIKERRAAHDSGEVEKETSKRM
MNFLDLMLSMEESNQLTSEDIRQEVDTFMFAGHDTTTSSTSWACWNLAHNPNVQE
KVYKEMIEVFGDDPNTDITLENVNNLNYLDIVLKESKRIIAPVPALQRKLTNDLEID
GYIVPAGGNVTISPMVLHSNHHVFKNPTEFNPDRFLPDEVSKRHPYDFMPFLAGP
RNCIGQKFAQLNEKVMISHIVRNFKIEPTLKYNDTKPCLEVVTKPSNGIPVRLIRRN
*
>Y108G3 contig 541   CYP29A3  504 aa

MSLILPCLLIILLLFIVSFWKIMKNILKYRKYDDQLPGPPAHPIFGNTKTFSNKTTE 
ISEIFQALRDLFSEAVEKGQSLIRHRILGTFYVWPLDGKTVSKILESTTELDKGGPYE
FFNDWLGGGTLLEGYGERWRSHRKMLTPTFSFAKMGGYLEVSIPESRVSLDCLD
KFAKSGETVDLFPFFKRCTLDTICKTAMGAKVDAQLQNSHPYITAIEQALQLGVSY
AMNPHHQIPAIYWALGHQKKKDEYFNIMKTFTRNVIAERRTARESGEVEKETSKR
NMNFLDILLSNEESSVLSPEDLRQEVDTFMFAGHDTTTTSVSWVCWNLAHHPDIQQ
NVYEEIVSVFGEDPNEDVTTEGIKKLEYTERMLKESKRICPTVPAVLRQLISDMEIG
GVLIPAGANVAIAPMAIHKNANIYQNPDIFDPDRFLPEETAKRHAYDFIPFSAGLRN
CIGQKFAQLNEKVMVIHLLKNFKIEPMGGYYSTKQVFEPVGKPSNGIPVRLVRR

>B0331 CYP29A4 500 aa

MSILIPVALALLFVYLLSFYDTIRLMRKFWIYGGKMPGPPAHPIFGNASLFKNKTX
SDFVELFVQLAHEARSKGANLMRTQVMNRIYVWPLNGKTAATILESSTEVNKGDD
YAFLVPWLGGGLLMEKGEKWKSHRRILTPAFHFAKLEGYLDVFNSESILIDCLEKI
AETQETVDLFPFFKRCTLDIICGTAMGIKLDAQNVHNLGYVQAVEGFNKLTVSYSL
NPFLWNRFVYWALGYQKMHDDFLYTLKKFTNDAIVERRTVIASGEIEKETSKRKM
NFLDILLNSEESNELTSDEIRKEVDTFMFAGHDTTSTSLSWLCWNIAHNPEVQENV
YKEIISIFGEDPNQDVTSENINRLEYTERVLKESKRMFPPVPGFQRKLTKDIVIGGITI
PSEGNITISPTVLHCNPFVYQNPEKFDPDRFLPEECAKRHSYDYIPFSAGLRNCIGQ
KFSILNEKVMLIHILRNFKLEPKLEFYETKPLFEVVAKPSHGIPVKLIKR

>C01F6.3 Z68213 CYP31A1P missing 25 amino acids at C-helix plus stop codon at ERK 
477 aa

MGVIILAVLLASATVIAWLLYKHLRMRQALKHLNQPRSYPIIGHGLITKPD
PEGFMNQVIGMGYLYPDPRMCLLWIGPFPCLMLYSGDLVEAIFSSTKHLNRGFAY
VLLEP
WLGISILTSQKEQWRLXXXXXXXXXXXXXXXXXXXXXXXXXKILVQKLCCLG
ADERVDVLSVIALCTLDIICETSMGIAIGAQLAENNEYVWAVHTINKLISKRTNNPL
MTEDGRTHEKCLHIFHDFTKKLIGERK*ALQENDYKMEGRLAFLDLLLEMVNSGM
DETDVQAEGNTFMLEGHDTTSTGLMWAVHLLGNHPDVQRKVQAELDEVMGDDE
DVTIEHLSRMKYLECALKEALRLFPSVLIITRELSDDQVIGGFNIPKGVTFLLNLYLV
HRDPAQWKDPDVFDPDRFHPENSIGRKSFAFIPFSAGSRNCIGQRFALMEEKVIMA
HLLRNFNIKAVELMHEVRPKMEIIVRPVTPIHMKLTRRRPIASP*

>F22B3     Z68336 CYP31A2 note: the first 4 bases of F22B3 overlap with H02I12 487 aa
>This gene is definitely different than CYP31A3, there are 8 amino acids differences and 
>the introns are divergent.

MGVIIPAVLLAMATVIAWLLYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFM
NQVIGMGYLYPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEP
WLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIFNEQSKILVQKLCCLGADEEV
DVLSVITLCTLDIICETSMGKAIGAQLAENNEYVWAVHTINKLISKRTNNPLITEDG
RTHEKCLRILHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETD
VQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDEDVTIEH
LSRMKYLECALKEALRLFPSVPIITRELSDDQVIGGVNIPKGVTFLLNLYLVHRDPA
QWKDPDVFDPDRFLPENSIGRKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRN
FNIKAVELMHEVRPKMEIIVRPVTPIHMKLTRRRPIVSP*

>T16C6    CYP31A3 486 aa this sequence revised according to Y17G9.contig 61
>cosmid T16C6 lies 3' of E04A4 and 5' of R11E3.  Y17G9 contig 61 covers this region.
>E04A4 ends at 29981 of Y17G9 contig 61
>R11E3 starts at 49037 of Y17G9 contig 61
>this sequence lies between 41545-45037

MGVIIPAVLLASATIIAWLLYKHLRMRQALK*HLNQPRSYPIVGHGLVTKP
DPEGFMNQVIGMGYLYPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLN
KGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIFNEQSKIL
VQKMCSLGAE*EEVDVLSVITLCTLDIICETSMGKAIGAQLAE*NNEYVWAVH
TINKLISKRTNNPLI*TEDGRTHEKCLRILHDFTKKVIVERKEALQ*ENDYKMEGR
LAFLDLLLEMVKSGQMDETDVQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQR
KVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRLFPSVPIITRELSDDQVIGGV
NIPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIARKSFAFIPFSAGSRNCI
GQRFALMEEKVIMAHLLRNFNVKAVELMHEVRPKMEIIVRPVTPIHMKLTRRRPIV
SP*

>CYP31A4P Pseudogene related to CYP31A sequences 44849-45028 of Y17G9.contig61 
>C-TERMINAL exon  fragment,  This sequence is inside the last intron of CYP31A3

MTHLLRNFSVKDVELVHEVRPKMEIIVCPVSPIHMKLTRRRPIISP*

>C26F1.2    U53148    CYP32 508 aa  also Y97E10 contig266

MIIVISIVIGYVIYLVVVNFQQILELWRINRKCAQNLSMVNGPPALPLVGSAHLFKW
NPYAFTFQMEGWAQKYLFGRAKYGEIAAPNNEVDGIMLLWIGPVPIVFLGTSECI
RPVLESNTNISKPSQYDKMSEWIGTGLLTSTHEKWFHRRKMLTPTFHFTIIQD
YFPVFVRNAEVLADAVELHVDGDYFDAFPYFKRCTLDIICETAMGIQVNAQL
GHNNEYVHAVKRISEIVWNHMKFPWLWLKPIWYLTGLGFEFDRNVRMTNN
FVRKVDAADNEASEKKRKAFLDLLLTIQKEEGTLSDEDIREEVDTFMFEGHDT
TSSGIGFTILWLGFYPECFETNQPPSMDDIKKCSYLEKCIKESLRMFPSVPLIAR
RLSEDVTINHPSGQKIVLPAGLAACVSPIAAARDPRAWPDPDTYNPDNFDID
AIAGRDPYAYIPFSAGPRNCIGQKFALLEQKTILSTFFRKYEVESLQTEENLRP
VPELILRPYNGMKIKIKRREAADYVVFTTFFRMKLDECEK*

>C12D5.7    U55365     CYP33A1 492 aa

MIFFLLLTAFVLYLFNEFYWKRRGLPPGPIPLPIIGNMIELFSYPPPTAAYDA
WTKKFGKIYTVWMGTDPAVIITGYKELKDTFVNDGHSYLDKMIYSKLNTSLR
GGDYGVIDTNGNTWKEHRKFALHTLRDFGMGKEAMEASIQLEVDKIDEELKK
VEGKEVNIQEHFDLAIGNIINQFLFGNRFKDSSKFNELKKLLDLFFEVQGSLRV
YFAYTVDFLPQWMVELLTPDVSRVRDGIYQFFDEQIEEHRQEIDFETSDSKDY
VETFMKEQKKREAEGDFASFSNEQLKNMCFDMWVAGMHTTTNTMGFLTAF
ALNNMDAQRKMQKELTEVIGDRVVTMKDKLNLPYTNAFINEAQRCANLVP
MNLPHAVTRDVQLLGCTIPKGTTVIHQISSVMSDPEIFEEPERFVPERYLDES
GNLKKIEELVPFSIGKRVCLGEGLARMELFLFTANSFNRYEFNCGSNGVPSLER
TFAFIAKAQDYTCQVKPRYSS*

>C25E10.2   U50311    CYP33B1 495 aa

MILIFFALCTLFFLIHQYLWRRRGLPPGPTPIPIFGNLFQLSGSEAPGISIFQKWKDQ
YGPIFTFYMGIAPFVVLTDYQDIKETVIKDGDTYADKYLSPEFNKYFREMQFTKLLS
GDRWKEHRKFAVLQLRELGVGKPLMESKILIEAEELIKKLKTAEILNEDFLLQSELD
VAVGSVINQFLFGYRFDRSKLFEFTRIKTLVNNFMEEVGKPLGVLAFTCHGIPSFL
VKLMVSGIEEQKRELFRFLRKQIDGAKSQINYEEEHNEDFVEAYLRKKFQREQKND
FDSYCDSQLENVCFDIWAAGFDTLTNTVGFLIAYAINYPEMQMLIHQEIDNYLAHH
SRLLTLADKNALVYFNAFANEAQRVSNILPMNLPHALTRDVKLKGYHLKKGTGVI
HQIANVMTDETIFKDSQRFDPNRFIDENGKLKKIEELCPFSMGKRQCIGEGLARMEI
FLLAANLFNYFEFLPASDGLPSLYKDFSLVSHVIPYKCRQYIP*

>C45H4.2    CYP33C1 502 aa

MIIILLLTFLTIYFVYELYWKRRNFPPGPCPLPVFGNLLSIANPPPGYKAFER
WTKKYGDVYTFWIGNTPHIMINTWDKIKETFIRDADTYTNKVVLPMVTLSR
GGEYGIIDSNGAMWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLD
AKLGSETDVPEVFDHAVANVVNQLLFGYRFMG*PKENEYQELKHIIDSPAEIF
GKLHIFLAMNIPIFAKLLPESLYEGPIKTFRDTTLAFFNKQIEAHRHRIDFEDL
NSESTDFVETFLKEQKRRESEGDSET*ANSKNLNFSNIQLLNVCIDLWFAGLNT
TTNTITWAISYVLHHPEVQDKIHEELDKVIGSDRLITTADKNDLPYFNASINE
SQRGINILPLNLQHATTRDTVIDGFKIPKGTGVVAQISTVMNNEEVFPDPYTF
NPDRFIDENGKLKKVDELAPFSVGKRSCPGEGLARMELFLFIANFLNRYQIHPS
KEGLPSMAKGSGPVVAPRLFTAILTRRF*

>C45H4.17   CYP33C2 384 aa missing C-terminal.  Intron after FIN to end of cosmid

MLIILLLTVLTVYLVYELYWKRRNFPPGPCPLPVFGNLLSIANPPPGYEAFE
RWTKKYGDIYTFWIGNTPHIMINTWDKIKETYIRDAETYTNKVRLPALDLFR
GGEYGIIDSNGATWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLD
AKLGSETDIPEVFDHAVANVVNQLLFGYRFVGVGFSKKKLTISII*PKESEYQE
LKRIIEAPTDLFGKPHMFLAMNIPVIAKLMPEFMYEGPFKDFRDTAFAFFNK
QIEAHRQEVDLNDLNSESTDFVETFLKEQKRRESEGDSETFR*FNSSNVQLSNV
CMDLWFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRLITTAD
KNDLPYFNAFIN

> Y10C10.CONTIG57 A POSSIBLE END TO 33C2.  This sequence does not match any other 33C sequence. 33C2 is found on Y10C10.contig 60 Y10C10 overlaps 33C2 and extends it 3'
            Length = 9830

  Minus Strand HSPs:

 Score = 514 (180.9 bits), Expect = 4.0e-55, Sum P(2) = 4.0e-55
 Identities = 96/105 (91%), Positives = 105/105 (100%), Frame = -3

Query:     1 ESQRGINILPLNLQHATTRDTVIDGFKIPKGTGVVAQISTVMNNEEVFPDPYTFNPDRFI 60
             E+QRGINI+PLNLQHATTRDTVI+GFKIPKGTGVVAQISTVMNNEEVFPDP+TFNPDRFI
Sbjct:  9063 EAQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRFI 8884

Query:    61 DENGKLKKVDELAPFSVGKRSCPGEGLARMELFLFIANFLNRYQ 102
             DE+GKLK+V+ELAPFSVGKRSCPGEGLARMELFLFIANFLNRY+
Sbjct:  8883 DEHGKLKRVEELAPFSVGKRSCPGEGLARMELFLFIANFLNRYK 8752

 Score = 102 (35.9 bits), Expect = 4.0e-55, Sum P(2) = 4.0e-55
 Identities = 20/31 (64%), Positives = 25/31 (80%), Frame = -3

Query:   105 IHPSKEGLPSMAKGSGPVVAPRLFTAILTRR 135
             I+PSKEG PSM K +G ++APRLF+A L RR
Sbjct:  8700 IYPSKEGPPSMDKSNGALIAPRLFSATLKRRS* 8602


>F41B5.4    CYP33C3 500 aa

MILLLVFTAFLAFLFHELYWKRRNLPPGPIPLPYMGNILTMLMNKPGYECFRNWT
KKYGDVYTFWMGKTPYVMISSYDLLKDTFVRDGDTYKDKYPQPFNQKIRGGNYG
IVESNGHLWNTHRRFALTTLRDFGLGKDLMHEKILIEVENIFKKFDAQLGLEQDVS
VVMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKV
GALLPGRSLDVLLEEWRDNFYSFFDTQIENHRKKIDFDSQESLDYAEAYLKEQRKQ
EALGEFELFSNKQLSNTCLDLWSAGLSTTYTTVTWALAYVLNSPEVLEKMRSELDE
VVGKDRFVTTADKNDLPYMNAAINEVQRCANLLPVNVAHATTRDTVINGYAIKKG
TGVIAQISTVMLDEKVFPDPYKFNPDRFIDEHGKLIKVEQLIPFSIGRRQCPGEGL
ARMEIFLFVANFFNHYQISPSSEGFPSIDKSDRVGVFPKKFKAILNRRFYGPSKEI*

>F44C8       CYP33C4 493 aa

MIILLVFTAFLAFLFHELYWKRRNLPPGPIPLPFMGNILTMLLNKPGYECFRNCTK
KYGDVYTFWMGKTPFVMISSYDLLKDTFVRDGDTYKDKYPQPLNQKIRGGNYGI
VESNGHLWSTHRRFALTTLRDFGLGKDLMQEKILIEVEDIFKKFDAQLGLEQDVSV
VMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKVG
ALLPGRSLNELLEEWRDNFYTFFDTQIENHRKKIDFDSQESLDYAEAYLKEQRKQE
ALGEFELFSNKQLSNTCLDLWLAGLSTTNTTVNWTICYVLNHPDVLQKMNEEFDQ
VVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKG
TGVIAQISTVMLDEKVFPDPYKFNPDRFIDENGKPIKIEQLIPFSIGKRQCPGEGL
ARMEMFLFLANFFNRYKISPSSKGFPNLDKKDNVGVFPKDLHAILNKRN*

>F41B5.3           CYP33C5  494 aa

MILLLLSAAVCLFLFHELYWKRRSLPPGPTPLPFMGNTLAMLLEKPGYECFRRWT
KQFGGVYTFWMGNIPYVIIGSYDLLKETFVRDGDTYKDKYPQPFNEKLRGGMYGI
VESNGHMWSTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFRKYDAQLGKEQDIQV
VLNNAIANVINQTIFGYRFDETNQEEFERMRHLVEYQEKQFATVKVYVEAFVPTIG
KFLPGKSLDQLLDDWRNSFYTFFDTQIENHRKKIDFDSEESQDYAEAYLKEQKKQE
ALGEFELFSNTQFSNTCLDLWLAGVSTTNTTVNWTICYVLNHPDVLQKMNEEFDQ
VVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKG
TGVIAQISTVMLDEKVFPEPYKFNPDRFIDENGKPIKIEQLIPFSIGKRQCPGEGLA
RMEIFLFLANFFNRYEISPSSKVFPNLDKKDNVGVFPKDLHAILNRRNC*

>F41B5.7      CYP33C6  496 aa

MIILLLSAAVCVFLFHELFWKRRHLPPGPTPLPFMGNILAVILEKPGYECFRRWTK
QFGDVYTFWMGNTPYIIIGTYDLLKETYIRDGDTYKDKYPHPFNEQLRGGMYGIVE
SNGHLWSTHRKFALSTLRNFGLGKDLMQENILIEVEDIFRKFDAQLGKEQEIQVVL
KNAIANVINQIIFGYRFDATNQDKLEKMRYLVEYQEKAFTTVKASIQAFAPRIGSILP
GKSLDQLLNEFKDNFYTFFNAEIENHRRKIDVDSEESQDYAEAYLKEQRKHEARGE
FELFSNTQFANTCLDLWLAGVSTTNTTVNWTICYVLNHPEVLQKMNEEFDQVVGS
DRLVSMGDKNNLPYFNAVLNESQRCANIVTINLFHATTKDTVINGYPIKKGTGVIA
QISTVMLDEKVFPEPYKFNPDRFIGENGKPIKIEQLIPFSIGKRQCPGEGLARMEI
FLLVANLFNRYQISPFSEGFPNLEKNSVVEIFAKGLRVILTKRHC*

>F41B5.2      CYP33C7 494 aa

MILLLLFTVLIAFLFHEMYWKRRNLPPGPIPLPLIGNLQSMLLEKPGYECFRRWNK
QFGDLYTFWMGNTPYVIVSSYELMKETFIRDGDTYKDKFPQPFNEKFRGGIFGIIET
NGHLWNTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFRKYDAQIDKDMEISTILH
NAIANVINQTIFGYRFDESNQEEYKKLKHLIEFQENVFTSAKVTVQVFAPKLGKILP
GESLEDLMKDWKNSFYDFFNTQIENHRQKIDFDSEESQDYAEAYLKEQKKYEALG
DTELFSNKQLSNTCLDLWFAGLSTTNTTANWTICYVMNTPGVLEKIHDELDKVVG
SDRLVTTADKNNLPYMNAVINESQRCTNIVPINLFHATTRDTVINGYPVKKGTGVI
AQISTVMLDEKVFPEPYKFKPERFIDESGKLIKVDELVPFSIGKRQCPGEGLARM
ELFLFIANFFNRYQISPSSEGLPSIDKSERVGVFPRKFNAILKKRHV*

>R08F11        CYP33C8 494 aa also Y39H10 contig 180

MFFILVLVLTGISIYLFHLLYWKRRNLPPGPTPLPLFGNTLPTLFDIPGYKTFGKLK
EQYGDAYTFWMG*KDPYVMICSYDLLKETFIRDADTYKDKDYNPIDEKIRGGIYGI
LQTNGHVWNTHRRFALTTFRDFGLGKDLMQQKILIEVEDMFRKLDENIGEEQDVP
TVLYNAVANVINQIIFGYRFEGVKQEEFTKLKELMEYLETAFATLKIYVEIFVPWIG
KLLPGKSLDDV*LNYWKDTSYEFFNSQIENHRLKIDFDTEESLDYAEAYLKEQKKQ
KAQGEFELFCDKQLSNNCLDLWTAGLSTTIITINWTICYIMNTPGVQEKMQEEMDK
VVGGGRLVTTADKNDLPYMNAVINEAQRCGNIVPLNLLHCTTKDTVINGYSVKK
GTGVVAQISTVMYDEKV*FPDPYTFNPDRFIDDNGKLVKIEQLIPFSIGKRQCLGE
GLARMELFLFIANFLNRYHISPGSSGLPSLDKSKGITPRKFEPVLSRRHA*

>C50H11     CYP33C9 495 aa

MVLNIILVVVVAFLFHHLYWKRRNFFPGPTPLPLIGNLLSLRNPAPGYKAF
ARWTAKYGDIYTFWLGTRPYILVSSYEALKETFIKDGETYADKKPMAFQESF
RGGSYGVVETNGPFWREHRRFAIHQFRDFGLGKDRMEQRIMLEVEDIFNNCDK
TIGEGVDLTDIFDRAVGNVINQMLFGYRFDE*TRADEFRTIRAFFNFNSGEFAS
FSMRVQFFLPWMGYIMPGPTILDRFKKYQKGFTEFFGTQIENHKKEIDFELEEN
SDYVEAFLKEQRKREASGDFES*SSTKQLSNMCLDLWFAALMTTSN
TMTWCFAYTLNYLDAQQKLHEELDRVIGSERHINTADKPNLPYTNAYINEIQ
RTANLVPLNLLHMTTRDTVLKGYNIPKGTGVVAQISTVMYDENV*FPEPYIF
KPERFLDDDGKLKKVEQLVPFSVGKRQCLGEGLARMELFLFIANFFNRYR*VV
PDANGPPIIDKAVLGGMHTKEFKAILQRRHVSE*

>F41B5.5    PSEUDOGENE      CYP33C10P 162 aa

MILILLFTACLAVVFHEIYWKRRHFPPVPIPLPLIGNLHSLILEKPRYESFRKWKKG
FGDVFTVWMG*TPYIMITSYDLLKETFIRDGDTYKDNYPQPFNEKFRGGLYGLIDS
NGLLWSTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFQKCDAQLGQEQD*

> Y49C4.CONTIG103 CYP33C11 new

8-232
4435 MIAFSIFIAIFFWLAHCFYFKRRNLPPGPTPLPFLGNSLSMIWENPGYECFRRWTRIYGDVF 4620
4621 TFWLGETFIKDGETYQDKIQFSFTEKFRGGRFGVIETTGHMWSTHRRFAI 4856
4857 STFRDLGLGKNLMQEKILAEVEAVFQILDANLGAEQDVPEVIYNAVANVINQ 5012
5013 MIFGYRFDE*SNQNEFEKLKDLIDIQEKSFASFKLCVQAFVPIMNKLLPGKSLED 5174
233-493
5831 RIAEKRHDYYNFFYAQIQDHRAKINYQAEEYL
5927 DYAEAYLKEQKNQEQGGLGSDL*FSDQQLANMCFDLWFAGLTTTNTTINWTISYVLNHPEV 6106
6107 QDKMQEELDKVVGSDRLVTISDKSSLPYMNAVINESQRCVNLLPCNLFHATTRDTVINGN 6286
6287 IIPKGTGVIAQISTVMLDEQIFPDPYKFQPERFIDENGALKKIEQLIPFSVGKRQCLGEG
LARMELFLIVANLFNRY 6559 maybe one extra amino acid here
6613 ITPSSAGPPSLERTEMVGVFPRKFQAILTRRY 6708 probably one more amino acid here

>K05D4.4     CYP33D1 485 aa this sequence was identified as CYP33D2, but they were
the same sequence on adjacent cosmids with some sequence errors.  CYP33D2 does not exist.

MLLLLISSLIFLFFAYHFSWKRRNYPPGPTPLPLVGNLLQLQKFGYDIFHKWK
KEFGPVFTFWLGK*RPFIFITSYEVMKETFVKDGDTFADKQLNQIDKKKLQRNY
GVLDTNGEMWREHRRFTLSQLRDLGLGKDLMQEKVFWVGTCRPTL*HCSIKD
LKRYFFPDPVLNLSQIFKFQNQRDEFTYLKSLIDGLRDVASEFRYFIQFLVPWS
SKIIPGPTLGDKTKGMKEELDVFFVKQVEEHRKEIDFDTVESYDYVEAYLKEQ
KK*FRGLLKCFLFSNKQLYAMCFDLWMAGLQTTTVTLTWGFSFYLHNADVQ
LKIREELDRVIGNDRLITTADKNCLPYLTAFINETQRCANIIPFNLLHVATRDT
VIEGYPVKKGTGVIAQIGTVMSDEQ*IFPDAHCFNPGRFIENGKLKKVDEVIPF
SIGKRQCLGEGLARMELFLFFANIFNRYDVQLDFSGNLPDLDKSKDNFVTPRKF
NAVLNKRYV*

>C54E10 CYP33D3 Y69H2 contigs 04354 and 04878 and Y80D3 contig 02849 488 aa

MLLLLIFSSIFLYFFYHFHWKRRNLPPGPRPLPFLGNLLSLKTLKPGYEAFSNWKK
EYGPIFTFWMGNKPFVIIASYEKMKETFVKDGDTYVDKQLTHTEKERLGENYGVL
DTNGHMWKEHRRFTLTQLRDLGLGKDLMQEKILMEVEELFKELDAHGGEEIDLPK
LIDRSVGNVINLTLFKRDEFAHLKSLIDGMRNVTSQSRYLIQYLVPWTS
TVLPGPTLSEKVRAKREELDDFFYSQIDEHRNEIDFDNTENLDFVEAYLKEQKKREE
DGDFSISSNKQLCAMLFDLWIAGLMTTTMTMTWGLSYYLYNPEVQRKIREELDKVI
GNDRLISTADKNDLPYLQAFVTETQRTANIIPLNLIHMTTRDTVIDGFPIQKGTGVIA
QISTVMYDEQVFPEPYKFKPERFIENGKFKKVDEVIPFSIGKRQCLGEGLARIELFLF
FANIFNRYDVMPDFSGSLPDLDKSKDNFVIPRKFKAVLKRRYMD*

>C49C8.4    U61945    CYP33E1 494 aa

MILLILTSILIIYLFNHFYWKRRKLPPGPIPLPIIGNLYLMTEDVKPGYKMYE
KLKDKYGPVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEM
RQGPYGIIESHGDRWIQQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSIRK
SMEDVDMQNIFDASVGSVINNMLFGYRYDETNIEEFLELKNRMNKHFKLAAE
PMGGLIGMNPWLGHLPFFKGYKNVIMHNWMGLMEMFRKQATDRLASIDY
DSDEYSDYVEAFLKERKKHENEQDFGGFRMEQLDSVCFDLWVAGMETTSNTLNW
ALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQRLANLLPMN
LSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLESDGSLKKVEE
LVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKFHESNPNPSIKKEVGVTMKA
KNYRVSMKERY*

>F42A9.5    U61952     CYP33E2 509 aa

MILFIVLSIVSIYLFDLFYWKRRNLPPGPLPLPLVGNLHMMSDDVKPGYSLF
SNLKEQYGHVYTFWMASLPIVHVTDWNLIKQHFIKDGGNFVGRPEFPMSIEL
RQGPYGIIESHGDRWVQQRRFALHVLRDFGLGKNLMEEKVLGEVTAMLDRL
RKTMDEVDMQSVFDASVGSVINNLLFGYRYDETNIAEFLDLKEKLNNHFQLA
AKPIGGLIGMNPWLGYFPYFSGYKNGLFYELVFIFKMCFIVMIQNWMGLVE
MFRKQANEKLATIDYESDDYSDYVEAFLKERKKHENEKDFGGFEMEQLDSVCF
DLWVAGMETTSNTLNWALLYVLRNPEVRQKVYEELDREIGSDRIITTSDKPK
LNYINATINESQRLANLLPMNLARSTTKDVEIAGYHIKKNTVIIPQISLVLYN
PEIFPEPYEFKPERFLESDGSLKKVEELVPFSIGKRQCPGEGLAKMELLLFFANL
FNRFDIQLHQSNPNPSVEKEFGVTMKAKSYRLKLKDRH*

>F42A9.4    U61952 PSEUDOGENE    CYP33E3P 236 aa

MILALSLALLFLYLFHFIYWKRRNLPPGPAPLPFVGNLLMLTEKVKPGYKL
WDSLTQQYGSVFTFWMAGLPMVFVTDWKLIKQYFIKDGGSYVGRPEFPLNT
EVKKGPYGIIDAHGNRWIQQRRFALHVLRDFGLGKNIMEEKILTEVTVMIER
LRKTIACVDMQNVFDTSIGSIINSLIFGYRFDESEFGWKFEKSRRACSIFNWKT
TVSRRRTCQNGIISVFCKLVQYIRYSTS*

>T10H4.10   Z81119       CYP34A1 504 aa

MFLVLLFFTIISLALAHQWRARKQLPRGPYPLPLIGNLHQLLYYCWKNGGLVEGY
AEIQKSFGKVYTLWIGPLPTVFIADFEVAHETHVKRAHEFGTRYAPGLMNYNRYE
RGVVASNGEFFQEHSRFVLSTFRNFASGRNIMEERIMDEYRYRFEDFASSNGICNK
ERKIFETWARPFFDLLTGSVINKILINERFEQNDPEFEKLVSRLAKGFENTGFLDIFC
PVRILESRFLKWRQDTIFEPFNYILELNKKSIARRVAQLKADEHVLSDDPDDFLDAY
LLKMQKDKNEGLETTFTLENLAVDMYDLWLGGQETTSTTLNWACACLLNRPDVIT
TAREELIRVTGGHRSLSLIDRRETPYLSAVISEVQRFASILNMNLFRIIKEDTVVDGQ
PLRAGTAVTAHIAMIHVDEDLFKNHTEFRPERFLENDDLDKKLIPFGIGRRSCLGES
LAKAELYLVLGNLLLDYDLEPVGEIPKLKTLAPFGLLKQSPEFRIRFVEVEKH*

>T10H4.11  Z81119       CYP34A2 502 aa

MFLILLFSTILAIALVHQWRARKQLPRGPYPLPLIGNLHQLFYYCWKNGGLVEGYA
EIEKSFGKVYTVWIGPMPTVFISDYDVAQETHVKRANVFGTRYAPGIMNYVRFDK
GVVASNGEFWQEHRRFALTTLRNFGFGRNIMEERIMDEYRYRFKDFATTGNNNM
AKSFETCARSFFDLLTGSVINKVLINERFEQDDADFEKLKTNLSRGLENTGFLDIFC
PVNILQSRFLKWRQDSIFQPLDWILELTKRNIAKRVAQLKSGEHVLHDEPDDFLDA
YLMKMYKDEKEGLDSTFTLDNLAIDMYDLWIAGQETTSTTLAWACACLLNKPEVV
LKAREELVHVTGGHRSLSLTDKKVTPYLSAVISEVQRVASILNVNLFRILEEDTYVG
GQPIRAGTAVTAHISMIHVDETLFKNHTEFNPERFLEVEGLDKKMIPFGIGKRACL
GESLAKAELYLVLGNMLLDYNLEPVGDVPKIQTITPFGLLKRPPPFKVRFVEVEKS*

>C41G6.1     Z81047     CYP34A3 492 aa also T13C10 Z81591

MIFVTLVTTILIYFSCKLWRGRKKNPNGPLPLPLIGNLHQLVYNSWKTGGIV
AGFQVFKKQYGKFFTLWFGPIPIVFIADYDIAYETHVKKANIFGHRFTTGVM
NYIREGRGIIGSNGAFWQEHRRFALTTLRNFGLGKNIMEDRIMDEYRYNPRLL
KNSRKNGVIEVNAATMFDLLVGSIINRMLVSKRFEQGNLEFETMKVYLTKA
LEEVSIFEAFLPVWLLKSNLLRWRTKYTLAPVEYIYSLVQKEIQERTTSIENG
SHVPSEDGDDFVDAFLIKIEKDKKEGIDSTFTLESLAIDLFDLWLAGQDTSSTT
LLWAGICLLNHPEVVEKLRSELLEVTGGIRRLSLTDRARTPYLMAVLNEIQR
IASILNINIFRELREDTEIDGQPIAAGTVVANQLSMIHTDEELFEDHTRFDPER
FIENSTLEKKLIPFNLGKRSCPGESLARAELYLIIGNLVLDFDFEAVGIKPEIKT
STPFGIMKRPPNYISD*

>T09H2.1  CYP34A4 485 aa

MLLILLFTTVLAILIIHQWIKRRNLPNGPTPIPIIGNLHQLFYLYWKHGGAVSAYRQL
EQTYGKVFTVWIGPLPTVYISDYDLAHETHIKKSNIFGARFAVGALNYIREGRGIVA
SNGEFWQEHRRFALTTLRNFGLGRNLMEEKIMEEYRYRFAQTGNGNNNKSSIET
NSSMFFDLLIGSIINQLLISERFEEFEKLKESLSIGLEKFGVLDIFLPDWIMNAWWM
KWRMDDILGPFSWIHRLSQRNVQRRMEQIESGEHVIDGDGTDFMDTYINKIEKDK
REGVDSTFTDLWIAGQETTSTTLSWACACLLNHPEVVKIAREELVHLTGGHRSISLT
DKTSTPYLNAVIEVQRIASILNVNIFRQTSEDTTVNGQPIAAGTALTTHLSLIHTDEN
LFQNHTEFRPERFLENNNLEKKLIPFGIGKRACLGESLARAELYLVTGNMILDYDL
QPIGEVPQIKTTSPCGIMKRPPVYSLRFVPVHHA*

>B0213.10 CYP34A5 499 aa

MFLILILTSILTYFSINLWRGRRRNPKGPLPLPLIGNLHQLIYNSWKTGGMVAGFQE
FKKHYGKFFTLWFGPIPIVFIADYDIAYETHVKRANVFGHRFTIGGMDYIREGRGI
VGSNGDFWQEHRRFALTTLRNFGVGRNIMEDKIMDEYRYRIQDFSKTHGKNGVIE
VNATTMFDLLVGSIINRMLVSERFEQGDQDFEKLKMYLTKALEELSIFDSFTPLWLL
KSRILRWRTKVTMAPFDFVYELVKNGIQKRTSEIKNGSHVISEEGDDFVDAFLIKIE
KDKKEGIDSTFTLETLAIDLFDLWLAGQETTSTTLTWAGTCLLNHPEVVEKLRKELI
QITGGTRSVSLTDRAQTPYLTAVVNEVQRISSILNVNIFRQLQEDSHIDGQPIASGSV
VTTQLAMIHTDEDLFKDHTKFDPERFIENNNLDKKLIPFGIGKRSCPGESLARAELY
LIIGNLVLDFNLEAVGVKPEIKTSTPFGLMKRPPNYNIRLIPVSH

>B0213.11 CYP34A6 498 aa

MLFILILTATVLILTVNIWRAWRKLPNGPLPIPLIGNFHQLFYYAWRFGGIVEGIKE
MKKQYGKVFTLWMGPLPMVNICDYDIAYETHVKRANIFVNRYIHGATEYIREGRG
IIGSNGDFWLEHRRFALTTFRNFGIGRNIIEGKIMEEYNYRFEDFHETHFKNGAIQV
SASMFFDLLVGSIINQLLVSERFEQDDKEFEELKTKLTMALENSSIIEGVMPLWLLK
SKFMKWRTKTTFAPFDFIYEVGQKGIQRRVAAIENGTHVLSEEGDDFVDAFIIKIEK
DSKEEVESTFTLETLAVDLFDLWVAGQETTSTTLCWAFVCLMNYPEVVEKLRNELT
EVTGGMRSVSLADRSSTLYLNATINEIQRIASILNVNLPRVLEEDALIDGVLVPAGTA
FATQLSAMHTDDETFKNHKEFNPERFMENNNLEKKLIPFGIGKRSCPGESLARAE
LYLIIANIVMEYEIEPVGATPKMKTPTPFSLLKRPPSYEIRFVKRS*

>B0213.12 CYP34A7 499 aa

MLIILILVAIAAVLTVNLWRARQKLPNGPTPLPIIGNFHQLFYNGWKYGGLVAGFD
QFRKQYGKVFTVWMGPIPAVQICDFDVAHETHVKKAHTFGHRYTFGAMEYIREG
KGIIGSNGDFWLEHRRFALMTLRNFGLGRNIIEDKIMEEYRYRFEDFKKTNFKDG
AIQVNASSLFDLLVGSIINQLLVSERFEQDDEEFEELKTNLAMALENGSIIEGVLPLW
MLKSRFMKWRTKTTFAPFDFVFEVGKKGIQRRVAAIENGTHTLSEEGDDFVDAFI
VKMEKDKKDGIDSSFTLETLAVDLFDLWQAGQETTSTTLTWACACLLNHPEVVEK
LRKELTEVTGGARGVSLTDRTKTPYLNATINEVQRISSILNVNLLRILEEDAVIDGHP
VPAGTAFTTQLALLHTDEETFKNHKEFIPERFLENNNLEKRLIPFGIGKRSCPGESL
AKAELYLIIGNLVIDFDLKPVGAIPKIESPTPFSPVKRPPVYDIRFISRAH

>B0213.14 CYP34A8 499 aa

MLLILILLAVAAVLTANLWRARQKLPKGPTPLPLIGNFHQLFYLSWKTGSLVAAFN
ELKKQYGKVFTVWMGPKPSVYICDYDIAHETHVKRANIFGTRYSVGGMEYIREGR
GIIGSNGDFWLEHRRFALMTLRNFGVGRTIMEDKIMDEYRYRFKDFKRTHFKNGA
IQVNASSIFDLLVGSIINQLLVSERFEQDDQEFEKLKTSLAEALENISIIEGFLPLWVL
KSPLMKWRTKITFAPFDFIFELGNRGIQRRVAAIENGTHTLSEEGDDFVDAFIVKME
KDKKEGIDSSFTLETLAIDLFDLWQAGQETTSTTLTWACVCLLNHPEVVEKLRKEL
TEVTGGTRGVSLTDRTKTPYLNANINEFQRIASILNVNLFRVLEEDTTIDSQPVPAG
ALVTTNLSMLHTDEEIFKNPQEFRPERFMENNNLEKRLIPFGIGKRACPGESLARA
ELFLITGNMILDYDLEPVGTLPKIETTTPFAPMKRPPVYDIRFVPRSQ

>B0213.15 CYP34A9 499 aa

MILILILSAIVAIFTVNLWRARQKLPKGPTPLPLIGNLHQLIYNAWKNGGIVQGFNE
FKKQYGNVFTIWMGPIPSVHIADFDVAHETHVKRANTFGHRFSNGGMDYIREGR
GIIASNGEFWQEHRRFALTTLRNFGLGRNIMEDKIMEEYRYRFKDFKNTHFKNGG
IQVNASSCFDLLVGSIINQLLVSERFEQDNKEFERLKTSLAKGLEKVSIFEAFMPVW
VLKSKLMRWRTKTTFEPFDFIFGLVERGIQKRVSAIKNGTHIPSEEGEDFVDAFLIK
MEKDKNEGIQSTFDLETLAVDLYDLWLAGQETTSTTLTWACACLLNYPEVVKEIRK
ELTEVTGGTRSLSLTDRPKTPYLGATINEIQRIASILNVNIFRLMEEDSIIEGQPISAGA
VLTTQLAMLHTDEKTFKNHTEFRPERFLENNNLEKRLIPFGIGKRSCLGESLARAE
LYLITGNMILDFDFESVGAAPRIQTPTPFALMKRPPSYDIRFIPRSK

>B0213.16 CYP34A10 499 aa

MLIILLLVTFFAVATAYQWRKCQRLPKGPTPLPLIGNFHQFIYYGIKLGSAVAVYHE
FEKTYGKVFTIWMGPLPSVYISDYDVAHESHIKRANIFSTRFAHGTTNYIREGRGII
AANGDFWQDHRRFALTTLRNFGLGRNLMEEKIMEEYNYRISDYKRTHLKNGAIEI
HAGTFFDLLVGSIINQLLISERFEQGDQEFEKIKTSLALSLENFGIIDIFFPTAILDSPL
MKWRQKKIFEPFDFIYEVSKRNLTKRMEAVKSGDHVIEDGGRDFVDAYILKIQKD
ENSGAPSTFNLETMIIDVFDLWQAGQETTSTTLTWAFCCLLNHPNVVKKLRAELM
KLTGGNRHVGLNDRADTPYLNAVCNEVQRIASILNINLFRKIEQDTEIAGQPLASG
CVVTTQMSMLHTDVEVYKNPTEFRPERFLENNTLEKKLIPFGIGKRSCPGESLARA
ELYLILSNVILDVEIEAVGSIPKILTSNPFGLLRRPPSYDIRFKPLKV

>C03G6.14    C13B3.B    CYP35A1 502 aa

MFLVLIFLALSCWLIIRQYQKVSRLPPGPVSFPIIGNLPHIIYYLWATGGIVS
TLDLFRKKYGNIFTLWVGPVPHVSICDYETSHEVFVKGANKYADIAHAPLFR
ELRRW*MGVLVTNGSHWSTMKRFALHTFRDMGVGKDLMETRIMEELDARC
ADTDKSATDGVTVAQAGDFFDLTVGSIINSILVGKRFEEHNKDDFLKIKEAMG
AAFEVFSPFDMAVPVWFLRTFFRSRYDMMMTTQNTAKRFAAAEAVKRIED
IKSGAYEIDESNIEDYTDAFLLKIQKDGEDLDF*NIETLKTMIIDLWMTGQETTTT
TLISGFTQLLLHPEVMVKAREEILKITENGSRHLSLTDRTSTPYLNAMIGEIQRHASI
LNVSFWKINKELTYMGGHPVDAGALVTAQLSALHVNDTIFKNPQEFDPERFIRDEE
LLQKVIPFGVGKRSCIGESLARAELYLVRHLQYRISNFLFRLLGTFCSAINSNRMEH
CRQQSCCRIAPEKDHSSWK*

>C03G6.15    C13B3.A     CYP35A2  495 aa

MFFVLFFSVLLGYLIVRQYQKVSRLPPGPISLPLIGNLPQIIYYLWSTGGIVST
LDLFRK*RYGNIFTLWVGPIPHVSIADYETSHEVFVKNAGKYADKFHAPVMR
DVRSK*IGVLITNGDHWQEMRRFSLQAFRNMGVGKDIMETRIMEELDARCSD
IDKLATNGVTITHASEFFDLTVGSIINSILVGKRFEEDTKHEFLKIKETMDASF
ETFSPFDMTAPVWFLKTFFKHRYDKIWSAQETAKNFAAAEAIKRVESIKSGKYVID
ENNLQDYTDAFLLKIQKEGESKDF*NIETLKTMIIDLWMTGQETTTTTLISGFNQL
LLHPEVMIKAREEILKITENGSRHLSLTDRTSTPYVNAVIGEIQRHASILNVSFWKIN
KEFTYMGGHPVDAGALVTSQLSALHVNETVFKNPQEFNPERFIRDGKLLQKVIPF
GVGKRNCLGESLAKAELYLVRFVFYRSSVTFSFATNSNNMANYPLPSLCHTALEK
DHSSWK*

>K09D9       CYP35A3 496 aa

MFFVLFIAACLSWLIVRQYQKVSRHPPGPISFPLIGNLPQICYYLWSTGGIVSALDLL
RK*KYGNIFTLWVGPVPYVSIADFETSHEVFVKNGGKYADKLHAPIMRDIRSM*K
GIAFTNGDHWQEMRRFSLQTFRNMGVGKDIMETRILEELDAR*CSDIDKSAKNGV
TVAQASEFFDLTVGSVINSILVGKRFEEDTKHVFLRIKNTIDESFKLITPFNTTVPVW
ILKTFFKDRYDKMADAQEIAKNFVAAEALKRF*EDIKSGKYVIDENNLQDYTDA
FLLKMQKEGENLDF*NTETLKTMLVDLWLTGQETTTTTLTSGFNQLL
LHPEVMVKAREELMNVTENGSRSLSLTDRSSTPYLNAMIGEIQRHASILNLSFWKV
NKEFTYIGGHPVDAGALVTAQLSALHVNETYFTNPQVFEPERYSQDEKLLQKIIPFG
VGKRSCLGESLAKAELYLVR*HGTFRSLETSFFAINSSHMENFRLPIXCHTALGGD
HSSWK*

>C49G7    CYP35A4 500 aa

MFVILFISAILSWLIVRQYQKVSRLPPGPVSLPLIGNLPQIFYYLWTTGSIVS
TLDLFRKRYGNIFTLWVGPLPHVSIADYEISHEVFVKNGSKYADKFHAPVMQ
DIRSI*MGIMVTNGDHWQHMRRFSLQTFRNMGVGKDIMETKIMQELDAR*C
AEIDTSAMNGVTVTQASEFFELTVGSIINSILVGKRFDATTKHEFLKIIETMD
ASIETASFFDMMVPVWILKTFFKHRYDNLSDAFEVSKAFSAAEAIKR*VDQI
KSGRYFIDENNLQDYTDAFLLKIEKEGQCQDF*NMETLKTMIGDLWITGQE
TTTTTLISGFNQLLLHPEVMVKAREELMKVTENGSRSLSLTDRASTPYLNAM
IGEIQRHASILNVNFWKINKEFTYMGGHPVDAGALVTAQLGTLHVNETVFE
NPLKFDPERYIRDENLLQKVIPFGVGKRSCLGESLARAELYLV*NYLLVDDENF
RSSEISFSAINSSQVQNYQPPSLLHTASERDHSSWK*

>K07C6.5    CYP35A5 495 aa

MMFILIVSLILTWLIVRQYQKVSRLPPGPVSLPLIGNLPQIVYYLWTTGGIVSTLDLF
RKRYGNIFTLWVGPVPHVSIADYETSYEVFVKQGNKLADVAHSPVLKEFSRGVGL
IRCNGEHWQVMRRFALQTFRNMGFGKEPMEIKIMEELDARCAEIDQASINGVTVTS
ASEFFDLTVGSIINSMLVGTRFEDHNKQEFLDIKNTMEESIGMFSPFDLTMPVWIM
KSFFRKRYDFLVGAQESARVLVASEALKRYDDIKSGKYVIDENNLQDYTDAFLLKI
VKGEDEKNFNIQALKTMLYDLWLTGQETTTVTLLCGFNHLLAHPEVMDKAREELL
KITENRARSLSLSDRPTTPYLNAMIGEIQRHASILNVTFWKINKELTYMGGHPVDS
GAVVTAQLGALHVNDTIFKNPREFDPERFIRDDTLLQKVIPFGVGKRNCLGESLAR
SELYLVGASFFRYLEIYFSDINLSHMASYQQRRQCRTVLQRERSTWK*

>K07C6.4   CYP35B1 499 aa

MIFVLLLTTFLAVLIIRQYQKARKLPPGPVSLPLIGNIHQLVYHIWNEKGVVPAFDLF
RKKYGDVFTIWLGPIPHVSICNYETSQEVFVKNGNKYKDRFLPPVYLHVSNNLGL
FTANGPVCAEMRKFTLLAFRNMGVGRDLMEQRILDELNTRCAEIDADAVNGKTIV
HTTEFFDLTVGSVINSLLVGKRFEAEDKDDFLEIKRLMAEAADLFTMFDLVVPVWF
LKSFFPSRFERVVAIFEKALNYLSREALARYEKLKTGEYSVNAEDPQDFVEAYLAK
MEQERLRDSDTPYTMECLKFVIGDLWLAGQDTTSTTLVAGFNHLVKNPEIVRKCR
EEILRITENGSRPLQLKDRAESHYLNATIAEIQRHASILNVNFWRLVHEPTTVQGHP
VDSGSVICAQLGALHVNDDLFKNPDKFYPERFIENEQLLSQIIPFGIGKRSCVGENI
AKSELYLMIGNLILRYDIKPHGSEPSTEDKLPYSAGKTPDKSVKLEFVKL

>K07C6.3    CYP35B2 499 aa

MIVILLLTTLIAFLVARQYQKAKKLPPGPVSLPLIGNIPQLVYYIWREKGVVPAFDLF
RQIYGDVFTIWLGPIPHVSICDYDTSQEVFVKNGSRLIDRFLPPVFLHLSNNLGLVS
ANGEVWAEMRRFTLLAFRNIGVGRDSMEERILEELDARCEEIDADAVNGKTVVQTS
DFFDLAVGSIINNTLIGKRFNAHNKDEFMKLKKMMDSASDLFTIFDLTAPVWMLKI
LVPKRCERILGVQEEILNFVSREANERYEQLKSGEYTVNAENPHDFVEAYFAKMEE
EKRHGGPTPYTMKCLKHVIGDLWLAGQDTTTTTLVSGFNQLVNHPEVIRKCREEI
LRITENGSRPLQLKDRAESHYLNATITEIQRHASILNVNFWRLINEPTNVKGYEIDS
GTVMTAQLGALHVNNDIFKNADKFYPERFIENGKLLNQVIPFGIGKRSCVGENLA
RSELYLLTGNLLLRYNIRPHGSLPSTADQLPYSAGKMPDKNVHLEFVKL

>K07C6.2 CYP35B3 499 aa

MIILIFITTLLTFLIVRQNQLSKKLPPGPIAFPIIGNIPQVAYYVWKTEGMVPALDLFR
KTYGNVFTIWLGPIPHVSICDYETSQEVFVKNGNKFKDRLLPPIFIHVSENLGLLTA
NGDSWAEMRGFTLLAFRNMGVGKDLMEKRILDELNARCAEIDADAVNGKTIVKIS
DFFDLTVGSVINSTLVGKRFEAHNKDEFLHLKKIIHVSSDIFTTFDMTVPVWVLKTF
FPGRFARSVEIQEEVLKYVSREASKRYDKMKLGEYTPSSEDPQDFVEAFLAKIDQEE
QTGGPTHFTMRCLNQVIADLWLAGQDTTATTLVSGFNQLVNNPEVMRKCREEIMK
ITENGYRPLQLKDRAETHYLNATIAEIQRHASILNVNFWRLVHEPTIVNGYEIDAGA
VITSQLGALHVNNDIFKDPSKFYPERFIENGKLLNQIIPFGIGKRSCVGENIARSELY
LMIGNLLLRYDIKPHGSLPSLDDKLPYSVGKMPDKTVELEFVKL

>C06B3.3    Z77652     CYP35C1 508 aa

MFFILLFVSIISFLTARQFLKAKRLPPGPFSLPLIGNAHQVGYQLWRTGGVTN
MLNHFRKEYGDIFTLWLGPIPHVNITNYELSHEVFVKNSTKYADKHVSPMID
YVRKGNGVFFSNGDKWQELRRFSMLTMRNMGMGRDLMEEKILSELDARCAE
INEKSIDGTTVLQVNEFFDLTVGSIINNMLLGFRFDERTKSRFLTMKHMFDEG
MDKMTPLFFTLPVWALQKFLAKDFNSIIKDQFEIIDYVSVDAIKRSRDFMNG
DYEIDPNNVEDIVDAFLLKMKQNPKSDVYESFSENNLKMLITDLWITGQETTTTTLV
SAFIQFLNNPQVMDTVQKELIKVTNGGSRQLSLRDKTETPYLNATIAEVQRHASILN
INFWRINNEPTVIGGHPVDSGCLIASQLSALHTNEKIFENPEKFNPERFIRNENLMQ
QTIPFGIGKRSCLGESLARAELYLVKTFFDKLISKCIYFRSLETYYSAIILNLLGKCH
PLEKPFRLALPRDAKPST*

>F14H3.10      CYP35D1 498 aa

MILILLFLTAITVITVRLYRKVLRFPPGPFPLPLIGNAHQIAYQAWRRGGILPALDYY
RK*YGNAYTLWLGPKASVSITDFETSQEVFVKQGKKCYNRQLAPILEHVTGGVGL
LIANGENWAEMRRFTLLTFRQMGVGTNIMEKRIMDELNGRCLEIDAQIARNDRAIV
DVKFFDLTVGSVINSFLIGKRFEDEEEFLKIKKLFDESSETFNIFDLNVPVWFLKTFL
PSRFKLTWDSRHQIMDHVMKGVEERIRDIESGAYKIDPKKPNDVVDAFLSKMKKE
EEIAGGQHPYYNLKSLKLVLHDLWLAGQGTTATTLYVGFMKLVNHPGIIQNIQKE
LLDITENGARDLTLKDRPNTPYLNATIAEIQRHASILNVNFWRINHETIHFNDYQVD
PGTMIAAQVGVLHVNEELFDNPKDFNVEKYLKNPKLLQQVIPFGIGKRSCVGEQIA
KSELYLVFGNILLRYNVKKHGSTPTNEDVYPYSSAKLPDVSGKLEFVKL*

>F14H3.A   PSEUDOGENE     CYP35D2P 128 aa not annotated in genbank

MILIALFFTIFTVITVRLYRKVLRFPPGPFPLPFIGNAHQIVYQAWSRGGTLP
ALDYYR*NGNAYTLWLGPKAPVSLTDFETSQEVFVKQGKKCYNRQLAPILEH
VTGGVGLLTANGENWAEMRRFTLR*

>C34B7.3     Z83220   CYP36A1 493 aa

MLFAQLVILVIIVMLFLCRFANKLRGLPPGPTPWPFIGNTFQVPEDRIDLIIN
EFKKKYGGIFTLWLPFPTIVICDYDMLKRNIVKNGESFSGRPDTFIMDMLVQG
NYGLFFMENNWWKAQRRFTTHIFRSLGVGQAGTQDTIASLASGLVEKIDGQK
DKPIELRPLLVHVVGNVIHKHLFGFTREWNETEILDFHVAINDVLEHFTSPK
TQLLDAWPWLAYLDKPLSLGIPRTTRANDAIIQNLEQALAKHKTGINYDEEP
SSYMDAFLKEMKIRAAENALEDGFTEKQLIVAIYDLYSAGMETIIIVLRFAFL
YLVNNPETQKRIHEELDRNVGRERQVVMDDQKHLPYTCAFLQEVYRLGYVLP
VNFLRCTLTDVEDCEGYRLNAGTRVIAQFQSVHVDKKHFPDPEHFNPDRFLNS
RGEYIRDDRVNPFSMGKRSCLGENLARMEVFLYFCTLMQNFEWHTDGPYAPP
IDVITSSLRAPKPFTVRASRR*

>F01D5    Z81493   CYP37A1 516 aa also Y39G8 Z92851 

MGIAVYLLALVVIYVVFNLSKILKFVK*ERMRLYHLMSKIDGPLALPLLGT
TFQFKMDPVEFALQLYNWGLEYSTKGSSLAAFWMGPYPMVIVLTPEANKVQTRN
MSGAQNFHIFQKVLESNALINKSSEYDIFLPWLGTGLLLASGEKWRGRRKMMTPS
FHFNVLIDEFANWDFQILLEQIENAAKKTDDSTIDAFPYIKRCALDIIC*ETAMGTTV
SAQTNHTHPYVVAVNEMNSLAFKYQRMPWLWIKPIRQLIGYEADFQRNLDIVTSFT
KKVIDRKLREHDETDGMVVVEEESKKKAFLDMLIE*EGGLGYEDIREEVDTFMFEG
HDTTSAGIGWSLWCLANCPEYQKKCHEELDEIFGEEFDSFDLKKMKYLEKCVKEA
LRMRPSVPQMARSVEEEVEI*DGKILPKGCSVMISPAFIQNNPRTFPNHEVFDPERF
NEDEISKRHAYAYIPFSAGPRNCIGQKFAMQEEKTVISWVLRRFHIHTDIGLLENMP
LPETITRPSLGFPLKFTVRQQ*

>F28G4 and T13F3      CYP37B1 515 aa

MHFLNIATIFLITIFLFYYKLIYNFIRDRLRIYKYMRKFDGPYSFPIIGTLYMV
NIFDISKFTTQSMELAQYYCQKGCGTIGLWLGPVPLIAVINPQHAKEILESNE
VITKAEEYDILFPWLGTGLLTSTGSKWRQRRKMLTPAFHFKVLNDFLSVHDY
QAKVRFFF*QIKPYADSGKEVDLFPYIKRLALDVICDTSMGVTIDAQNNHDHQYVE
WVF*LLSEYAFEWILRPWLRLKPLWYLTGPGHEYDRHLKIVTDFTKTVIKEKWEEF
QKFHVDPVVKTDKRSMAFLDLLLELRNEGLMNEDDIREFEGELRFSAAD
LSQVTGHDTTSASMGWTLWCLAHNPEFQEKVIQEVDGIFGTSDRDCTNDDLKQM
KYLEKCLKESLRMYPSVPFFGRTVEQDVVI*DGDFFPKGVRIIVMPLLLQRNPLIFD
NPNQYNPENFSEDKIGSRHAYSDIPFSAGPRNCIGQKFAMMEEKAVISWFFRKYR
VTASQPFGMNKILPELILKSSVGISVDSASSD*

>CM08B12    M89401, AL020988 Y80D3 contig 01341 and 00427 504 aa CYP42

MGIITASLIVLTITWIIHFAFRKAKFIYNKLTVFQGPAALPLIGNFHQFHFSPEEFFEQ
SQGIAYMMRKGDERITRVWLGGLPFVLLYGAHEVEAILGSPKMLNKPFLYGFLSA
WIGDGLLISRKPDKWRPRRKLLTPTFHYDILKDFVEVYNRHGRTLLSKFEAQAGT
GEYSDVFHTITLCTLDVICEAALGTSINAQKDPHSPYLDAVFKMKDIVFQRLLRPHY
FSDTIFNLIGPGKEHDECVKVIILHEFTSKAIYARKQLLAQETAEGRRRMAFLDLML
DMNSKGELPMEGICEEVDTFTFEGHDTTSAAMNWFLHLMGANPEIQSKVQKEIDE
VLGEADRPVSYEDLGKLKYLEACFKETLRLYPSVPLIARQCVEDIQVRGHTLPSGTA
VVMVPSMVHKDPRYWDDPEIFNPERFITGELKHPYAYIPFSAGSRNCIGERFAMME
EKCILAIILKNLKVKAKLRTDEMRVAAELIIRPLYGNELKFEKREFGDYTSIY*

>E03E2.1 485 aa CYP43

MCSMIGDQTFSVLRGATPVVITSNVDLIHAISTEHFDCFHSRICICCSILIVHQGSKM
KNYCNTAKILKLCIFYNNYLQPEILSDDPITSDNIHMFAAKGERWKRLRTLTSYGL
STVKLKLLFPTMDTCVSEFMDHVNSLSDGQSVVINHSHSLFQNHTSYVLARKAFG
NFAELQKSTAEKIAYIFPETKLIFKNSFVGHFLKSATQQKFLDYLLHLISNFQSRKN
VDNNNGICCTENDHYSLLGFFFEHHNEKKLIEKAEGQIDMKKVKVEKSISYEEITA
QCKFISVAGFDTTSNTLTLLFNFLANNPDVQDKIYEAEIKNQPEQISFETVSSLRLLQ
NCIFETLRLFPHASPLQTRICTEPFKIGKYQFLENVQIVVNPWGPHHDREIWGNDV
DCFRPSRFENLTEQQRKAFMPFGVGPRQCVGMRFALLEMKTTAFRMLQKYSVF
TNSPVHDRHGKTVRMTVRDTGTIWPTDKLGLVLKQR

>CELZK177  cosmid ZK177 U21321 CYP44 Probable mitochondrial P450 489 aa
C70591 is an EST from the middle region that adds 49 amino acids not previously 
identified as coding region in ZK177. Another exon extended 13 amino acids helps fill in the missing I-helix region with DGLSTT matching with AGXDTT of the I-helix.
* indicates possible intron locations ** indicates verified introns based on ESTs.

MRRSIRNLAENVEKCPYSPTSSPNTPPRTFSEIPGPREIPVIGNIGYFKYAVKS*
DAKTIENYNQHLEEMYKKYGKIVKENLGFGRKYVVHIFDP*ADVQTVLAADGKTPFIVPL
QETTQKYREMKGMNPGLGNL*NGPEWYRLRSSVQHAMMRPQSVQT*YLPFSQIVSN
DLVCHVADQQKRFGLVDMQKVAGRWSLESAGQILFEKSLGSLGNRSEWADGLIEL
NKKIFQLSAK**MRLGLPIFRLFSTPSWRKMVDLEDQFYSEVDRLMDDALDKLKVNDSDS**
KDMRFASYLINRKELNRRDVKVILLSMFSDGLST*TAPMLIYNLYNLATHPEALKEIQKE
IKEDPASSKLTFLRACIKETFRMFPIGTEVSRVTQKNLILSGYEVPAGTAVDINTNVL
MR**HEVLFSDSPREFKPQRWLEKSKEVHPFAYLPFGFGPRMCAGRRFAEQDLLTSL
AKLCGNYDIRHRGDPITQIYETLLLPRGDCTFEFKKL

>F54E5 contig 00150  CYP51 fragment identical to human and rat 51sequences 
(contamination).  C. elegans may not have a CYP51 gene. 59 aa

DVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLP
SFR