May 30, 2000

Arabidopsis P450 Statistics

P450 Families

Named P450 Sequences

Full Length Sequences

Sequences in Genomic DNA

Percent of genome completed

Predicted P450s

45

264

240

264

92.3%

286

Recent progress

AL353865 CYP71B38 chromosome 3, BAC clone T10D17 79% to 71B5 29822-28106
AL163817 CYP724A1 62148-65132 translation given in Genbank is not correct 
chromosome 5, BAC clone F18O22 gene = F18O22_190 in 85 clan
AC025417 CYP87A2 now complete 82132-84239
AC026480 CYP96A14P 9579-10061 Pseudogene fragment chr I clone F15E12
no more downstream seq in 80000 bp GSSs: B20346, B22314
9579 MALIGLIEAFIAFVCFLIFYYFLIKKPYSYILIKISQSGLWNWPVLGMSPGALMRLP
RIYDFSVDLLESNLTFHFKGPWFAGIDILATADSVNINHIYYRGPELREIFGPFGDGIINSD
SELWRNLKKATQVIFNHQKYQKFSTSTTRSKLKLGLVPLFN 10061
AL353995 CYP81K1 chr 5 clone F12B17 comp(9841-11343) EST AI997093
AL353995 CYP81K2 chr 5 clone F12B17 comp(11529-11633,11733-11837,12108-13583) 
AF241643 CYP75B1 exon 1
AF241644 CYP75B1 exon 2
AF241645 CYP75B1 exon 3
AF241646 CYP75B1 exon 4
AF241647 CYP75B1 exon 1 mutant
AC025814 CYP721A1 64213-66048
AL163972 CYP94D2 89747-91303 chromosome 3 clone T5P19 88% to 94D1
AL162973 CYP96A13 69536-71045 70% to 96A12 my translation does not agree
    With the translation of the Genbank entry.  Small intron vs frameshift?
AL162972 CYP77A4 NOW COMPLETE 25962-27500 clone T1E3  also on AL162875 T32M21
AL162875 CYP77A9 87274-88803 T32M21_230 no GSSs no ESTs
AC061957 CYP86A4 comp(37593-39264) chromosome 1 clone F22L4
AC051629 CYP72C1 chromosome I clone F6I1 partial seq

AC027656 CYP78A5 comp(32530-34190) EST T45256 formerly confidential

AP001298 CYP71B33 comp(479-2126)
AP001298 CYP71B34 comp(2977-4644)
AP001298 CYP71B35 comp(4867-6557)
AP001298 CYP71B36 comp(8161-9842)
AP001298 CYP71B37 comp(10654-12314)

AP001304 CYP705A28  13048-14798 same as AL091537 T7 end of BAC T8C3 = B77649
AP001304 CYP705A29P 15786-16553
AP001304 CYP705A30  15786-16553 part of old 705A7X
AP001304 CYP705A31P 20651-20824
AP001304 CYP705A32  21561-23630 Identical to B74035 part of old 705A7X
AP001304 CYP705A33  24249-25900 2 amino acid diffs with B96118

AP001307 CYP90D1 comp(43183-45689) 51% to 90C ESTs = AI994541, R30379, R30380

AP001314 CYP702A8 comp(11921-14547)

AC025417 CYP87A2 67020-68647 75% to 87A1 partial seq

AC024226 CYP86D2P comp(6890-7005) numerous deletions and frameshifts
   GSSs AL080732, AQ010792

AC024609 74483-77023, AC025808 CYP722A1 35% identical to CYP90A1

AC010795 CYP87A3P pseudogene fragment

AC023628 CYP703A2 comp(16084-17699) 75% to 703A1 EST AA720028
This sequence family was not known in Arabidopsis before Feb 16, 2000.
703A1 is from petunia
AC023628 CYP78A8 94000-96000 region

AC023279 comp(55362-56858) CYP94D1 F12K21 chr 1 formerly CYP86D1 March 6, 2000

The TIGR Arabidopsis site has sequenced several thousand reads from a second 
Arabidopsis variety called Landsberg erecta looking for polymorphisms.  A search of 
all the partial arabidopsis P450 sequences in my collection (ESTs, GSSs and 
incomplete mRNAs and genomic clones) found only one extension, 
a C-terminal sequence was identified for CYP707A3 which had previuosly 
been missing the C-terminal.  The sequence was present in the AB020744 genomic 
clone, but there were some errors that prevented recognizing it as the true end of 
this gene.  I have now searched exhaustively for new P450s in this data.  The 
entire set of 1944 contigs was downloaded and searched by TBLASTN using the 
do-it-yourself BLAST server at 
http://www.proweb.org/proweb-bin/WU-blastall.pl
This search was done using nine different P450s from the nine clans of Arabidopsis
P450s CYP51A2, 71B9, 72A8, 74A, 85A1, 96A1, 97C1, 710A1, and 711A1.  These are 
usually sufficient to find all known Arabidopsis P450s in a database.  11 contigs 
were shown to contain P450s.  

Contig #  best P450 match  % identity

281       707A3 C-terminal 360-470 this sequence used for correct end of 707A3
391       706A4             100% C-terminal 462-516
404       82C2              100% C-terminal 356-508
505       79C1              100% N-terminal 8-74
610       71B7              100% C-terminal 244-480 with intron
885       71B3              100%   middle   252-342 with intron
1241      79C1              100% C-terminal 423-545
1510      79B2               99% C-terminal 343-541 one difference
1531      705A3              95% N-terminal 1-91 4 differences
1538      98A3              100% N-terminal 1-161 
1783      51A1               99% N-terminal 21-142 one difference

On Jan. 28, 2000 TIGR deposited 14905 entries from the Landberg erecta data
These GSS accession numbers start with AQ.  At least 48 of these sequences are P450s
And they match 25 different Arabidopsis P450s and two match a Deinococcus radiodurans
bacterial P450 at 44% identity.  This clone may be a contamination of the genomic 
library.

AQ961078 LERFJ05TR LERA Arabidopsis thaliana genomic clone LERFJ05
96% to 51A1

AQ961077 LERFJ05TF LERA Arabidopsis thaliana genomic clone LERFJ05
99% to 51A1

AQ966708 LERIL68TFB LERG Arabidopsis thaliana genomic clone LERIL68
100% to 71A19

AQ968500 LERJC87TF LERG Arabidopsis thaliana genomic clone LERJC87
97% to 71A24

AQ968501 LERJC87TR LERG Arabidopsis thaliana genomic clone LERJC87
96% to 71A24

AQ968537 LERJD18TR LERG Arabidopsis thaliana genomic clone LERJD18
97% identical to 71A26 N-terminal

AQ957646 LERAQ88TF LERA Arabidopsis thaliana genomic clone LERAQ88
99% to 71B3

AQ957647 LERAQ88TR LERA Arabidopsis thaliana genomic clone LERAQ88
100% to 71B3

AQ963043 LERGJ13TR LERG Arabidopsis thaliana genomic clone LERGJ13
98% to 71B4

AQ956837 LERAM36TF LERA Arabidopsis thaliana genomic clone LERAM36
100% to 71B7 0ver 225 amino acids

AQ956838 LERAM36TR LERA Arabidopsis thaliana genomic clone LERAM36
100% to 71B7

AQ968000 LERIW96TR LERG Arabidopsis thaliana genomic clone LERIW96
100% to 71B23

AQ967999 LERIW96TF LERG Arabidopsis thaliana genomic clone LERIW96
100% to 71B23

AQ962171 LERGD74TF LERG Arabidopsis thaliana genomic clone LERGD74
93% to 76C3 N-terminal

AQ962172 LERGD74TR LERG Arabidopsis thaliana genomic clone LERGD74
92% to 76C3

AQ968833 LERJF09TR LERG Arabidopsis thaliana genomic clone LERJF09
100% to 78A8

AQ968883 LERJF37TF LERG Arabidopsis thaliana genomic clone LERJF37
100% to 78A8

AQ968884 LERJF37TR LERG Arabidopsis thaliana genomic clone LERJF37
100% to 78A8

AQ960047 LERFB09TF LERA Arabidopsis thaliana genomic clone LERFB09
100% to 79B2

AQ960048 LERFB09TR LERA Arabidopsis thaliana genomic clone LERFB09
98% to 79B2

AQ956517 LERAK44TR LERA Arabidopsis thaliana genomic clone LERAK44
100% to 79C1

AQ956516 LERAK44TF LERA Arabidopsis thaliana genomic clone LERAK44
98% to 79C1

AQ958944 LEREG05TR LERE Arabidopsis thaliana genomic clone LEREG05
100% to 79C1

AQ958943 LEREG05TF LERE Arabidopsis thaliana genomic clone LEREG05
98% to 79C1

AQ969559 LERJO25TR LERG Arabidopsis thaliana genomic clone LERJO25
99% to 81D2

AQ969558 LERJO25TF LERG Arabidopsis thaliana genomic clone LERJO25
97% to 81D2

AQ959582 LEREL64TR LERE Arabidopsis thaliana genomic clone LEREL64
1 difference with 81G1 96%

AQ956256 LERAI92TF LERA Arabidopsis thaliana genomic clone LERAI92
99% to 82C2

AQ956257 LERAI92TR LERA Arabidopsis thaliana genomic clone LERAI92
100% to 82C2

AQ968189 LERIW66TF LERG Arabidopsis thaliana genomic clone LERIW66
100% to 83A2

AQ968190 LERIW66TR LERG Arabidopsis thaliana genomic clone LERIW66
97% to 83A2

AQ964979 LERGZ64TR LERG Arabidopsis thaliana genomic clone LERGZ64
100% to 96A11

AQ964978 LERGZ64TF LERG Arabidopsis thaliana genomic clone LERGZ64
100% to 96A11

AQ960246 LERFB51TF LERA Arabidopsis thaliana genomic clone LERFB51
100% to 98A3 N-terminal

AQ960247 LERFB51TR LERA Arabidopsis thaliana genomic clone LERFB51
100% to 98A3

AQ960228 LERFB40TR LERA Arabidopsis thaliana genomic clone LERFB40
99% to 705A3

AQ960227 LERFB40TF LERA Arabidopsis thaliana genomic clone LERFB40
95% to 705A3

AQ965033 LERGZ92TR LERG Arabidopsis thaliana genomic clone LERGZ92
100% to 705A4

AQ965032 LERGZ92TF LERG Arabidopsis thaliana genomic clone LERGZ92
100% to 705A4

AQ958087 LERAU82TR LERA Arabidopsis thaliana genomic clone LERAU82
95% to 705A22

AQ958546 LERAY24TR LERA Arabidopsis thaliana genomic clone LERAY24
100% to 705A22

AQ958987 LEREG36TR LERE Arabidopsis thaliana genomic clone LEREG36
100% to 706A4

AQ958986 LEREG36TF LERE Arabidopsis thaliana genomic clone LEREG36
100% to 706A4

AQ958546 LERAY24TR LERA Arabidopsis thaliana genomic clone LERAY24
98% to 706A6

AQ962106 LERGD38TR LERG Arabidopsis thaliana genomic clone LERGD38
100% to 707A1

AQ956035 LERAH08TF LERA Arabidopsis thaliana genomic clone LERAH08
98% to 707A3

AQ956036 LERAH08TR LERA Arabidopsis thaliana genomic clone LERAH08
98% to 707A3

AQ969679 LERJP26TR LERG Arabidopsis thaliana genomic clone LERJP26
44% to a Deinococcus radiodurans P450 sequence
this may be a bacterial contamination of the genomic library
it does not match any other plant sequence at better than 30%

AQ969679      DLIVSLTGPYVAGLDTVANTTAAITYTVLKHPDVLKRVHDEVDALFADGTIGEEDLLKRI 61
              D+ ++  G ++AG+DT AN+ A + Y +  H + L  +  E DALF DG    E  L R 
AE002014 1317 DVRLAALGAFIAGMDTAANSLAFVLYRMHLHSEFLPALRAEADALFRDGPPTAE-ALGRS 1141

Query: 62   PSLQGAIMETMRLYPIAVAQMRSATKDFVFEGHQIYEGEMIYVGTSVPHFMHEYWPEPEN 121
            P L   +MET+R++PIA A  R+ T+D  F GH+I  G  + +GT+VPH + E +P+PE+
Sbjct: 1140 PLLHRFVMETLRVHPIAPALSRTLTEDVEFAGHRIPAGTPVIIGTTVPHGLPELFPDPEH 961

Query: 122  FDIDRYAKPRAEHMQPGVYSPYGRGPHTCLGKSLAEIQIALSMARLFYKLDLELESPNYK 181
            FD  R+A  RAEH QPG Y+P+G G HTC G  +AE  I L  A     LDL LE P+Y 
Sbjct: 960  FDPGRFAPGRAEHRQPGAYAPFGVGSHTCAGSGMAEGLIMLGAAAALRTLDLSLE-PDYV 784

Query: 182  LKTKTAPTP 190
            L+    PTP
Sbjct: 783  LRQTAKPTP 757

AQ969672 LERJP23TF LERG Arabidopsis thaliana genomic clone LERJP23
Same seq as AQ969679

The EU Chromosme 3 sequencing project has been sequencing the bottom arm of 
Chromosome 3.  Many clones are available on their web site some have
been deposited in Genbank, others have not.  See
http://www.genoscope.cns.fr/externe/English/Projets/Projet_S/S.html


AB036059 CYP78A9 also found on contig 31 of clone F21F14 from the EU chr 3 project 
8955-10728 numbering will change as contigs are joined (formerly confidential)

clone T27I15 contig 5 from European Chr. 3 project contains CYP76C7 and CYP76C8P

AC010926 CYP87A3P chromosome I clone IGF-F28P22
This appears to be a pseudogene remnant with two small exons and a frame shift
64524 NFMAFGDGMRLCIGADFS 
64585 KLQTAVFLHSSVTKYRWEETSGGNILRTPGLQ 64764
64765 FPNGYHVKLKKKEI* 64809

AL133421 AB005249 CYP75B1 chromosome 5, BAC clone F13G24.190
join(67348..67797,68521..68961,69040..69210,69291..69770)

AC016662 CYP78A10 chromosome I clone IGF-F2P9
64% to 78A2 comp(102654-104343)
MYLSFASRSGSSPFPSLELCLSIFLFISLFVFWLTPGGFAWALYKARFHTRPESKTGPAI
PGPSGLPIFGLLLAFVNNALTHRILANIADTCKAKALMAFSVGSTRFVITSEPETAKELL
NSSAFADRPVKESAYELLFDRAMGFAPFGDYWRELRRISSTHLFSPKRIFSSGESRRKIG
QNMVGEIKNAMECYGEVHIKKILHFGSLNNVMSSVFGKTYNFNEGIVYSKESNELEHLVS
EGYELLGIFNWSDHFPGMRWLDLQGVRRRCRSLVGRVNVFVGKIINDHKSKRSLRDNPEE
STYDDDFVDVLLGMHGNSKLSDSDMIAVLWEMIFRGTDTVAILLEWILARMVLHPDIQAK
AQAEIDCIVGDSGRQVTDSDLPKLPYVRAIVKETLRMHPPGPLLSWARLSIHDTQIGTHF
IPAGTTAMVNMWAITHDEKVWPEAHEYKPERFLGAQESNNFPIMGSDLRLAPFGAGRRVC
PGKSMGLATVELWLAQLLGSYKWVSCGEVDLSETLKLSLEMKNTLVCKAIPRG*

AL132979 contains (Chr III T3A5) 90B1
AC013428 contains (Chr III F18K10) 77A6, 77A7
AF184833 contains an inhibitor tagged site of 81D5
AC013288 14837-27604 contains CYP81D10 74% to 81D2 chromosome I clone T12I7
AC013258 63642-65480 CYP721 new family in the 72 clan most like CYP72B
AL132969 clone F8J2 from the EU Chr 3 project comp(64780-66639) 
contains a new CYP76G1 seq.
AL133315 clone T8P19 comp(10683-12101) from the EU Chr 3 project 
contains a new CYP94B3 seq.
AL132958 clone T04D02 from the EU Chr 3 project contains 71B5 and 3 new 71Bs (71B30P, 
71B31, 71B32) and 97C1 (formerly a confidential sequence) may be AL132958?
71B30P, 71B31 and 71B32 are also found on AL132966
AL132966 clone F4P12 from the EU Chr 3 project overlaps T04D02 and contains two of the 
three new 71Bs and part of the third 
AC012561 contains CYP705A25, CYP705A26P and CYP705A27
AC012396 contains CYP720A1 a new family related to CYP90 in the 85 clan
AC011622 contains CYP86A7 formerly only known as a partial EST sequence
AC011765 contains CYP98A8 and CYP98A9
AC011624 contains CYP94B2 a duplicate of AB010797 and AC011664
AC011664 contains CYP94B2 a duplicate of AB010797 and AC011624
AF195115 contains CYP86A2
AP000601 provides the missing 38 internal amino acids for CYP86C2
AB010077 contains CYP77A8P pseudogene 
51066-51110 (26-40), 56196-56252 (167-185), 56264-56377 (195-232), 75123-75146 (233-
240)
AC011560 contains CYP77A6 and CYP77A7
AB010797 AC011624 and AC011664 contain CYP94B2
AC010164 contains CYP76C5 and CYP76C6
AC010155 contains CYP705A24
Deposit of almost 8000 Arabidopsis ESTs identifies 9 new P450 sequences
and 11 ESTs match named P450s that previously did not have an EST in the 
database.  The new sequences are not named but fall in the following families 
and subfamilies
71B, 72A(2 sequences), 81, 89A, 90, 94B, 96A, 97A
CYP78A9 is submitted (confidential)
AC009895 CYP89A9 (9/8/99) has 6 ESTs
AP000414 CYP77A5P (9/8/99)
AP000419 clone MVI11 has CYP707A4 (9/7/99)

10 new CYP705A sequences have been found from Kazusa clone MAL21 AP000383 
8/3/99.

There has been no significant progress on Arabidopsis P450s since the July 2nd 
deposit of AL080318 from the EU Arabidopsis sequencing project.  The AGI 
sequencing totals have not budged in several weeks.  (A search done 7/29 found 
AC008051 that has a new P450 CYP79C2 and three pseudogene fragments related to 
it.)

CYP706A4, CYP706A5, CYP706A6 and CYP706A7 are on AL080318 and CYP83A2 is 
on AL080283.  45 other GSS fragments with P450s have been deposited.  Seven of 
these are new fragments that do not match known sequences exactly.  These are in 
the 71B(2 seqs), 705A(4 seqs) and 98(1 seq) families or subfamilies.

96A9, 96A10, 96A11 and 96A12 are on AL078620.

Note: only three new Arabidopsis P450s sequences have been found since May 9 
(96A7, 96A8, 72C1).  There has been a slowdown in the discovery rate for these 
genes.  I noticed that the Kazusa site has not made a new deposit of chromosome 
3 and 5 sequence data since May 7, and their webpage has not been updated since 
May 7.  I expect a large deposit of a months worth of sequence data will 
probably appear soon, hopefully with several P450s.  Examining the Kazusa FTP 
site, There are 17 clones (1Mb) marked as being sequenced on the May 7 web page 
that are now available by FTP (June 7) but they are not in Genbank yet.  My 
experience is that there are P450s about every 830 kb, so there ought to be one 
clone in this set with P450 genes.  A preliminary BLAST search of these 17 
clones with a CYP71B sequence did not detect any P450s.
 

Arabidopsis cytochrome P450 data


45 families of P450s have been named in Arabidopsis.  (Note 713A has been merged 
with 71A, after addition of many new 71A sequences).  264 sequences have been 
assigned names.  240 of these sequences are full length (or missing only a short 
N-terminal or C-terminal piece).

24 sequences have been named based on incomplete sequences.  22 of these 
are pseudogenes that contain lone exons or incomplete sequences that are missing 
exons and these will never be completed. CYP71B30P, CYP72A12P, CYP76C8P, CYP77A5P, 
CYP77A8P, CYP79A4P, CYP79B4P, CYP79C3P, CYP79C4P, CYP79C5P, CYP86D2P, CYP87A3P, 96A14P, 
CYP702A4P, CYP702A7P, 705A10P, 705A11P, 705A14P, 705A17P, 705A26P, 705A29P and 
705A31P.  Two 71A17P and 96A6P are ordinary pseudogenes. 

There are at least 264 P450 genes based on comparing gene sequences with 
distinct overlapping ESTs and GSSs in each family. There are a few additional 
sequences and contigs that do not overlap, but some of these may be from the 
same genes.  The CYP71 family seems to have the largest group of sequences with 
a minimum of 55 genes.  The CYP81 family has at least 17 genes.  The 705 family 
has at least 33 genes.

The best estimate I can make about how many P450s Arabidopsis will have is based 
on the number of P450 genes sequenced only from genomic high throughput 
sequencing.  The genome is currently (Feb. 9, 2000 data) 84.7% complete from 
the  MOT tables .  Another 
estimate is from the Arabidopsis Genome Initiative at 
92.3% (May 30, 2000)  AGI total.  
This is more accurate because it includes 
unfinished genomic sequences that are not included in the MOT tables.  I have now 
switched to the AGI total for this calculation.  I am assuming now that 
all of the Arabidopsis genome has been sequenced based on this 
effort and not from individual gene cloning projects.  From counting the genes 
identified from the genomic data alone I find 264 P450 genes 
listed below.  If 264 P450 genes have been found in 92.3% of the genome then I 
estimate there will be 286 P450s in Arabidopsis.  This number assumes a random 
distribution of genes on the chromosomes and that the sequencers have not 
skimmed the highest gene density regions first.  This number seems surprisingly 
high. There are approximately 22 more P450 genes that remain to be found, though 
some are represented by ESTs or GSS fragments.  The FASTA file of Arabidopsis P450 
sequences has 302 entries.

264 P450s found in Arabidopsis genomic sequencing

51A1,     51A2,     71A12,    71A13,    71A14,    71A15,    71A16,    
71A17P,   71A18,    71A19     71A20     71A21,    71A22,    71A23,    
71A24,    71A25,    71A26,    71A27     71A28     71B2,     71B3,     
71B4,     71B5,     71B6,     71B7,     71B8,     71B9,     71B10,    
71B11,    71B12,    71B13,    71B14,    71B15,    71B16,    71B17,    
71B18,    71B19,    71B20,    71B21,    71B22,    71B23,    71B24,    
71B25,    71B26,    71B27,    71B28,    71B29,    71B30P,   71B31,    
71B32,    71B33,    71B34,    71B35,    71B36,    71B37,    71B38,    
72A7,     72A8,     72A9,     72A10     72A11,    72A12P,   72A13,    
72A14,    72A15,    72B1,     72C1,     73A5,     74A,      74B2,     
75B1,     76C1,     76C2,     76C3,     76C4,     76C5,     76C6,     
76C7,     76C8P,    76G1,     77A4,     77A5P,    77A6,     77A7,     
77A8P,    77A9,     77B1,     78A5,     78A6,     78A7,     78A8,     
78A9,     78A10,    79A2,     79A3P,    79A4P,    79B2,     79B3,     
79B4P,    79C1,     79C2,     79C3P,    79C4P,    79C5P,    79F1,     
79F2,     81D1,     81D2,     81D3,     81D4,     81D5,     81D6,     
81D7,     81D8,     81D10,    81F1,     81F2,     81F3,     81F4,     
81G1,     81H1,     81K1,     81K2,     82C2,     82C3,     82C4,     
82F1,     82G1,     83A1,     83A2,     84A1,     85A1,     86A1,     
86A2,     86A4,     86A7,     86A8,     86B1,     86C1,     86C2,     
86C3,     86C4,     87A2,     87A3P,    88A3,     88A4,     89A2,     
89A3,     89A4,     89A5,     89A6,     89A7,     89A9,     90A1,     
90B1,     90C1,     90D1,     93D1,     94B1,     94B2,     94B3,     
94C1,     94D1,     94D2,     94D3P,    96A1,     96A2,     96A3,     
96A4,     96A5,     96A6P,    96A7,     96A8,     96A9,     96A10,    
96A11,    96A12     96A13,    96A14P,   97B3,     97C1,     98A3,     
98A8,     98A9,     701A3,    702A1,    702A2,    702A3,    702A4P,   
702A5,    702A6,    702A7P,   702A8,    703A2,    704A1,    704A2,    
705A1,    705A2,    705A3,    705A4,    705A5,    705A6,    705A8,    
705A9,    705A10P,  705A11P,  705A12,   705A13,   705A14P,  705A15,   
705A16,   705A17P,  705A18,   705A19,   705A20,   705A21,   705A22,   
705A23,   705A24,   705A25,   705A26P,  705A27,   705A28,   705A29P,  
705A30,   705A31P,  705A32,   705A33,   706A1,    706A2,    706A3,    
706A4,    706A5,    706A6,    706A7,    707A1,    707A2,    707A3,    
707A4,    708A1,    708A2,    708A3,    709A1,    709A2,    709B1,    
709B2,    709B3,    710A1,    710A2,    710A3,    710A4,    711A1,    
712A1,    712A2,    714A1,    714A2,    715A1,    716A1,    716A2,    
718A1     720A1,    721A1,    722A1,    724A1

All 264 named P450 genes are found in genomic sequencing.  There are no confidential P450s from Arabidopsis.

The most frequent P450 Arabidopsis ESTs are from CYP90A1 (16ESTs),
CYP83A2 (12ESTs), CYP76C2 (8 ESTs), CYP71B20 (7 ESTs), CYP73A5 (7 ESTs) 
CYP98A3 (7 ESTs), CYP86A1, (7 ESTs), CYP86A2 (6 ESTs), CYP708A2 (6 ESTs), 
CYP706A1 (5 ESTs and 7 more that could be either 706A1 or 706A2), CYP71B6 (5 
ESTs), CYP71B7 (5 ESTs), CYP85A1 (5 ESTs)

124 named Arabidopsis P450 sequences have no ESTs present in the EST database
This does not include the 24 pseudogenes (see named genes with P on end of 
name).  This has not been double checked since the new Arab ESTs have been deposited with 
AW and AV accession numbers.

CYP51A1,  CYP71A14, CYP71A15, CYP71A18, CYP71A19, CYP71A20, CYP71A21, 
CYP71A23, CYP71A24, CYP71A27, CYP71A28, CYP71B8,  CYP71B9,  CYP71B10, 
CYP71B12, CYP71B13, CYP71B14, CYP71B15, CYP71B16, CYP71B17, CYP71B21, 
CYP71B22, CYP71B23, CYP71B24, CYP71B25, CYP71B26, CYP71B27, CYP71B29, 
CYP72A9,  CYP72A10, CYP72C1,  CYP75B1,  CYP76C1,  CYP76C3,  CYP76C4,  
CYP76C7,  CYP77A4,  CYP77A6,  CYP78A6,  CYP78A7,  CYP78A8,  CYP78A10, 
CYP79A2,  CYP79B3,  CYP79C1,  CYP79C2,  CYP79F2,  CYP81D1,  CYP81D2,  
CYP81D3,  CYP81D6,  CYP81D7,  CYP81D10, CYP81G1,  CYP82C2,  CYP82C3,  
CYP82C4,  CYP82F1,  CYP82G1,  CYP86A4,  CYP86A8,  CYP86C1,  CYP86C3,  
CYP86C4,  CYP86D1,  CYP88A4,  CYP89A3,  CYP89A4,  CYP89A6,  CYP89A7,  
CYP89A8,  CYP90B1,  CYP93D1,  CYP94B1,  CYP94B2,  CYP96A1,  CYP96A2,  
CYP96A3,  CYP96A5,  CYP96A7,  CYP96A8,  CYP96A9,  CYP96A10, CYP96A11, 
CYP96A12, CYP98A8,  CYP701A3, CYP702A1, CYP702A2, CYP702A3, CYP702A5, 
CYP702A6, CYP705A2, CYP705A3, CYP705A4, CYP705A6, CYP705A8, CYP705A9, 
CYP705A12,CYP705A25,CYP706A3, CYP706A4, CYP706A5, CYP706A7, CYP707A2, 
CYP707A4, CYP708A1, CYP709A1, CYP709A2  CYP709B1, CYP709B2, CYP710A2, 
CYP710A3, CYP710A4, CYP711A1, CYP712A1, CYP712A2, CYP714A1, CYP714A2, 
CYP715A1, CYP716A1, CYP716A2, CYP718,   CYP720A1, CYP721A1

4 plant families are not yet represented in Arabidopsis (80, 92, 99, 719) 
CYP703 is the most recent family to be removed from this list Feb. 16, 2000.
CYP717 was on this list, but it has been joined with CYP81.
CYP80 and CYP719 are only seen in ranunculales and may be specific to this 
group. CYP92 is seen in both monocots and dicots so it is expected to be found 
in Arabidopsis. CYP701 was removed from this short list.
CYP701A3 is the ent-kaurene oxidase gene GA3. 
CYP95 has been discontinued as a family since it contained a significant 
sequence error It was really a member of the CYP72A subfamily.

P450 list with accession numbers, ESTs and GSSs


CYP51A1 Complete sequence AC002329

CYP51A2 Complete sequence AC007296 comp(52507-54167) ESTs: N65031, 
AA651059, AA720360 no GSSs

CYP71A12 Complete sequence AC002340 T11J7.14 no ESTs

CYP71A13 Complete sequence AC002340 T11J7.16 ESTs H76866, AA605540 

CYP71A14 Complete sequence AF069716 10000-14000 region no ESTs

CYP71A15 Complete sequence AF069716 16000-19000 region no ESTs
GSS: AL093403 BAC T11H3

CYP71A16 Complete sequence AB022210 comp(26631-24211) ESTs AA395422, 
T43806

CYP71A17P pseudogene on AB017065

CYP71A18 Complete sequence AC007296 83847-85677 no ESTs no GSSs

CYP71A19 Complete sequence AL049608 11443-13432 no ESTs no GSSs

CYP71A20 Complete sequence AL049608 21221-23811 no ESTs no GSSs

CYP71A21 Complete sequence AL049659 comp(61576..62187,62279..63139) 
also U31288 (fragment) GSS B25921, AL080661 BAC F1I22

CYP71A22 Complete sequence AL049659 comp (64631..65242,65328..66188) EST 
N38590 GSS: AL096411 BAC T16P17

CYP71A23 Complete sequence AL049659 comp (67262..67861,68005..68856)

CYP71A24 Complete sequence AL049659 comp(70246..71784)

CYP71A25 Complete sequence AL049659 comp (73216..73830,73929..74786) 
ESTs AA395671, T22148, AI100632

CYP71A26 Complete sequence AL049659 comp(76207..76818,76952..77809)

CYP71A27 Complete sequence AL022224 F1C12.160a this sequence is really 2 genes
represented as one gene. no ESTs

CYP71A28 Complete sequence AL022224 F1C12.160b this sequence is really 2 genes
represented as one gene. no ESTs

CYP71B2 Complete sequence D78605 also AC007357 31915-33510 ESTs: T43466, 
Z18072, Z35218

CYP71B3 Complete sequence D78602 no ESTs

CYP71B4 Complete sequence D78603 ESTs: T21833

CYP71B5 Complete sequence D78601 clone T04D02 EU Chr 3 project EST AI997548

CYP71B6 Complete sequence D78604 ESTs: F14179, F14199, F15479, N65349, 
F19855 GSS: AL095273 BAC T14L18

CYP71B7 Complete sequence X97864. also AC007357 39975-41560 ESTs: R65111, 
T04541, T04814, T44310, T44875

CYP71B8 Complete sequence AB011485 no ESTs GSS: AL089388 BAC T3M21

CYP71B9 Complete sequence AC004136 no ESTs 47% identical to 71B1

CYP71B10 Complete sequence AB019233 no ESTs or GSSs

CYP71B11 Complete sequence AC006259 and AC005964 ESTs Z33963, Z33677 
GSSs B28673, AQ011301, B78204, AL095836 BAC T15N16, AL087348 BAC F14D13

CYP71B12 Complete sequence AC006259 and AC005964 no ESTs or GSSs

CYP71B13 Complete sequence AC006259 and AC005964 no ESTs GSS: AL089222 
BAC T3H8, AL084167 BAC F8E24

CYP71B14 Complete sequence AC006259 no ESTs or GSSs

CYP71B15 Complete sequence AB016889 no ESTs or GSSs

CYP71B16 Complete sequence AB024038 comp(13279-14849) no ESTs no GSSs

CYP71B17 Complete sequence AB024038 comp(15932-17496) no ESTs no GSSs

CYP71B18 Complete sequence AB024038 comp(18089-19609) ESTs ESTs AA650762, 
T44224, AI099821 (2 diffs) T44855 (3 diffs) GSS B25335

CYP71B19 Complete sequence AB024038 comp(21194-22760) ESTs H76241 no GSSs

CYP71B20 Complete sequence AB024038 comp(26044-27630)  ESTs T04186, T45449, 
T21193, AA585920 (1 diff) T20987 (3 diffs) T04452, T04714 (these two not in 
GenBank 
anymore, but = AA585920) no GSSs

CYP71B21 Complete sequence AB024038 comp(31112-32720) no ESTs 
GSS AL092575 BAC T10E10, AL092574 BAC T10E9

CYP71B22 Complete sequence AB024038 36984-38609 no ESTs no GSSs

CYP71B23 Complete sequence AB024038 comp(40969-42839) no ESTs no GSSs

CYP71B24 Complete sequence AB024038 comp(45837-47529) no ESTs 
GSSs AQ011201 (5 diffs/178 = 97%) B96063 4 diffs/126 = 97% these
may be a related gene.

CYP71B25 Complete sequence AB024038 comp(75254-76832) no ESTs no GSSs

CYP71B26 Complete sequence AB024038 comp(80407-82076) no ESTs no GSSs

CYP71B27 Complete sequence AC007357  28180-29804 GSSs B11396, B21019

CYP71B28 Complete sequence AC007357 34549-36103 ESTs T76255, T20906, T14112, 
N65665, AI100027 GSS: AL093252 BAC T11D21

CYP71B29 Complete sequence AC007357 36686-38241

CYP71B30P Partial sequence T04D02 from the EU Chr 3 project
82204-83671 missing N-term 80 AA

CYP71B31 Complete sequence T04D02 from the EU Chr 3 project
84593-86302 GSSs AL092788 AL081333 No ESTs

CYP71B32 Complete sequence T04D02 from the EU Chr 3 project
87497-89156 two in frame stop codons may be a pseudogene

CYP71B33 AP001298 comp(479-2126)

CYP71B34 AP001298 comp(2977-4644) ESTs Z33952, Z34037, Z34791, two diffs with Z34126

CYP71B35 AP001298 comp(4867-6557)

CYP71B36 AP001298 comp(8161-9842)

CYP71B37 AP001298 comp(10654-12314) EST Z27299 GSS B22554

CYP71B38 AL353865 complete sequence 29822-28106 chromosome 3, BAC clone T10D17 
79% to 71B5 

CYP71D3X Complete sequence = 71B37 EST Z27299 

CYP72A7 Complete sequence AB023038 EST R90024

CYP72A8 Complete sequence AB023038 no ESTs

CYP72A9 Complete sequence AB023038 no ESTs

CYP72A10 Complete sequence AB023038 no ESTs

CYP72A11 Complete sequence AB023038 ESTs H36129, T04134, T13009

CYP72A12P Complete sequence AB023038 no ESTs GSS B24203

CYP72A13 Complete sequence AB023038 ESTs T44202, N96036, N96740, T22603

CYP72A14 Complete sequence AB023038 ESTs H36956, Z46541, Z46540

CYP72A15 Complete sequence AB023038 ESTs T45915, T22449

CYP72B1 Complete sequence AC003105 42% identical to 72 from Cath. roseus 
ESTs T04442

CYP72C1 Complete sequence AC007651 45% identical to 72A9 also on AC051629

CYP73A5 Complete sequence U71080/U71081 and U93215. ESTs: F19837, N65601, 
T04086, T43776, T44874, AA395398, AA657317

CYP74A Complete sequence X92510 and AB007647. ESTs: N65720, 
AA394958(almost identical)

CYP74B2 Complete sequence Z97339 ESTs T20864, AA395621

CYP75B1 AB005249 AL133421 chromosome 5, BAC clone F13G24.190
join(67348..67797,68521..68961,69040..69210,69291..69770) no ESTs no GSSs

CYP76C1 Complete sequence AC003680 F17K2.9 no ESTs

CYP76C2 Complete sequence AC003680 F17K2.10 ESTs H37250, T04013-T04017
Z33828, Z34697 GSS: AL084053 BAC F8B14

CYP76C3 Complete sequence AC003680 F17K2.11 no ESTs GSS: AL088340 BAC T1M7

CYP76C4 Complete sequence AC003680 F17K2.8 no ESTs

CYP76C5 Complete sequence AC010164 F14M2

CYP76C6 Complete sequence AC010164 F14M2

CYP76C7 Complete sequence clone T27I15 contig 5 from European Chr. 3 project 

CYP76C8P nearly complete missing last exon and an internal deletion
clone T27I15 contig 5 from European Chr. 3 project

CYP76G1 Complete sequence Clone F08J02 from the EU Chr 3 project comp(64780-66639) 

CYP77A4 Complete sequence AL162972 25962-27500 clone T1E32 also on AL162875 T32M21
GSS B97241 from BAC T32M21TR no ESTs GSS: AL082681 BAC F5F6 

CYP77A9 Complete sequence AL162875 87274-88803 T32M21_230 no GSSs no ESTs

CYP77A5P C-terminal fragment AP000414 13981-14298 Matches EST H36337
but this is probably not from this pseudogene, but from the parent gene.

CYP77A6 Complete sequence AC011560 71181-72725 chromosome III clone F13M14
No ESTs, GSS B30234 

CYP77A7 Complete sequence AC011560 72998-74939 chromosome III clone F13M14
GSSs B25606, B24360, AL093147 ESTs AI995272 W43241

CYP77A8P pseudogene fragments AB010077 clone MYH19
51066-51110 (26-40), 56196-56252 (167-185), 56264-56377 (195-232), 75123-75146 (233-
240)

CYP77B1 Complete sequence AC007296 comp(89516-91048) ESTs Z30775, Z30776
noGSSs

CYP78A5 Complete sequence AC027656 comp(32530-34190) EST T45256 no GSSs
chromosome 1 clone F21F23

CYP78A6 Complete sequence AC005819 no ESTs no GSSs

CYP78A7 Complete sequence AB016893 no ESTs GSS AQ011443

CYP78A8 Complete sequence AC007323 comp(15232-17051) no ESTs no GSSs

CYP78A9 Complete sequence EST AI995549 no GSS
contig 31 of clone F21F14 from the EU chr 3 project 
8955-10728 numbering will change as contigs are joined 

CYP78A10 Complete sequence AC016662 no ESTs no GSS chr I clone F2P9
64% to 78A2 comp(102654-104343)

CYP79A2 Complete sequence AB010692 comp(11000-13200 region) 
I helix motif not strong no ESTs

CYP79A3P Complete sequence AB025602 14755-16760 no ESTs no GSSs

CYP79A4P Lone C-terminal exon AB025602 22090-22536 no ESTs GSS B61504

CYP79B2 Complete sequence AF069495, AL035708 T5J17.120 ESTs: T42902, 
AA395121

CYP79B3 Complete sequence AC006592 comp(103303-105685) BAC F14M13 85% 
identical to 79B2 noESTs noGSSs also AC007168 76873-79255 clone T26C19

CYP79B4P lone exons AC006592 comp(101836-101952) and comp(102489-102605) 
also AC007168 79953-80069 and 80606-80722 clone T26C19

CYP79C1 Complete sequence AC007202 comp(77381-79610) clone T8K14
AC002986 comp(75-1680) nearly complete sequence (missing C-terminal exons) no 
ESTs

CYP79C2 Complete sequence AC008051 1899-4148 four frameshifts, might be a 
pseudogene

CYP79C3P partial sequence AC008051 5709-6541 pseudogene fragments

CYP79C4P partial sequence AC008051 7210-7435 pseudogene fragments

CYP79C5P partial sequence AC008051 9049-9895 pseudogene fragments

CYP79F1 Complete sequence AC006341 comp(71509-69310) ESTs F14189, F14190
GSS: AL093101 BAC T11A9

CYP79F2 Complete sequence AC006341 comp(75131-73147) no ESTs 
98% identical to GSS B20058

CYP81D1 Complete sequence D78606 formerly CYP91A1 families joined no ESTs
also on AB026661 comp(8484-10672)

CYP81D2 Complete sequence AL035601 F6G17.10, Z99707 no ESTs GSS AQ250603
AL091699 BAC T8H13

CYP81D3 Complete sequence Z99707 seq. (b) nucleotides 1167-2731 no ESTs

CYP81D4 Complete sequence Z99707 seq. (c) nucleotides 3301-5134
ESTs T41670, T42716, T43640, AA395149

CYP81D5 Complete sequence Z99707 seq. (d) nucleotides 6180-7938 no ESTs

CYP81D6 Complete sequence AC002391 T20D16.15 no ESTs

CYP81D7 Complete sequence AC002391 T20D16.18 no ESTs

CYP81D8 Complete sequence ESTs H76015, T41596, N38687, AA586064

CYP81D10 Complete sequence AC013288 14837-27604 74% to 81D2 
chromosome I clone T12I7 GSSs B22310, B21261

CYP81F1 Complete sequence D78607 formerly CYP91A2 families joined 
ESTs T42723, AA394371, AA597575, AI1000386

CYP81F2 Complete sequence EST T88150 no GSSs

CYP81F3 Complete sequence AL035601 F6G17.50 EST AA712784 (formerly 81D9)

CYP81F4 Complete sequence AL035601 F6G17.60 ESTs T46441, AI099973, AA598000
GSS: AL090945 BAC T6O13

CYP81G1 Complete sequence AB007645 comp(7177-8746) no ESTs

CYP81H1 Complete sequence Z99707 seq. (e) nucleotides 9042-11495 
ESTs: F13573, F13574

CYP81K1 Complete sequence AL353995 chr 5 clone F12B17 comp(9841-11343) EST AI997093

CYP81K2 Complete sequence AL353995 chr 5 clone F12B17 comp(11529-11633,11733-11837,12108-13583) 

CYP82C2 Complete sequence AL021636 (F10N7.200) also AL049607 no ESTs

CYP82C3 Complete sequence AL021636 (F10N7.220) also AL049607 no ESTs

CYP82C4 Complete sequence AL021636 (F10N7.230) also AL049607 no ESTs

CYP82F1 Complete sequence AL031369 no ESTs GSSs B29081, B27454

CYP82G1 Complete sequence AB026647 comp(36473-38300) no ESTs no GSSs

CYP83A1 Complete sequence: U18929, U69134, D78599 AL035528 ESTs: T88085, 
AA389789 GSS: AL095159 BAC T14I2

CYP83A2 Complete sequence D78598 formerly CYP83B1 also AL080283 clone F3L17
ESTs: N65459, R30228, R86798, T44634, T46080, T75944, T76397, T88645, 
Z33831, Z34720, AA404945, T20600

CYP84A1 Complete sequence U38416 also AL022141 EST AA598015

CYP85A1 Complete sequence AB009048 ESTs: N65267, T76590, AA394869, AA404883, 
AA713019

CYP86A1 Complete sequence: X90458, ESTs:  R90073, T45669, Z26357, 
Z26358, Z35025, AA712696, AA605446 GSS: AL088478 BAC T2A13

CYP86A2 Complete sequence AF013293. ESTs: H76762, T04172, N95869, T46373
T46372, Z25705

CYP86A4 Complete sequence Y09581 11000-12678bp region AC061957 comp(37593-39264) 
chromosome 1 clone F22L4 no ESTs

CYP86A7 Complete sequence AC011622 43171-44742 clone F24D7 EST F14165

CYP86A8 Complete sequence AC004665 77% identical to CYP86A2 no ESTs
GSS: AL089168 BAC T3F17

CYP86B1 Complete sequence AB007648 (comp. 14676-16659) 
ESTs AA586187, T20562

CYP86C1 Complete sequence AC000103 F21J9.9 no ESTs

CYP86C2 Complete sequence AB024038 1-1074 AP000601 ESTs Z26059 
Z26058

CYP86C3 Complete sequence AC007357 comp(51369-52931)

CYP86C4 Complete sequence AC007357 comp(54696-56285)

CYP86D1X missing C-terminal AC023279 18465 - 19850 11-FEB-2000 no ESTs GSS B97734, AL084336 BAC end F8K5 renamed CYP94D1

CYP86D2PX AC024226 comp(6890-7005) numerous deletions and frameshifts
   GSSs AL080732, AQ010792 Renamed CYP94D3P

CYP87A2 Complete sequence AC025417 82132-84239
64% identical to 87A1 ESTs H77048, N37614 and AI995175

CYP87A3P AC010926 chromosome I clone IGF-F28P22
This appears to be a pseudogene remnant with two small exons and a frame shift
64524-64809 

CYP88A3 Complete sequence AC000098 YUP8H12.23 (85724-87912) ESTs: T43711

CYP88A4 Complete sequence AC005700 no ESTs GSS: AL088126 BAC end T1G2
AL088480 BAC end T2A14

CYP89A2 Complete sequence U61231. ESTs: H77059 probably identical to CYP89A8
with some sequence errors and three frame shifts.

CYP89A3 Complete sequence AB010073 no ESTs

CYP89A4 Complete sequence AC005897 no ESTs GSS: AL087677 BAC F14M11
also an exact match to 89A7

CYP89A5 Complete sequence AC006193 ESTs H77059, T42576 no GSSs

CYP89A6 Complete sequence AC006193 no ESTs no GSSs

CYP89A7 Complete sequence AC006193 no ESTs GSS: AL087677 BAC F14M11
also an exact match to 89A4

CYP89A8X Complete sequence AC006193 no ESTs no GSSs see CYP89A2

CYP89A9 Complete sequence AC009895 37255-38905 clone T21P5 54% to 89A4 
ESTs T76749, T44110, T45663, T14186, T21361, AA394479

CYP90A1 Complete sequence: X87367, X87368 and AB005237. ESTs: N37221, 
N38445, N65494, N97134, T22324, T22325, T41675, T43151,T43286, Z17988, 
Z26124, Z29017, Z29018, AA394655, AA586079, AA720263
GSS: AL087931

CYP90B1 Complete sequence AF044216 clone T03A05 EU Chr 3 project DWF4 gene no ESTs

CYP90C1 Complete sequence Z99708 ESTs: AA651564, N96214

CYP90D1 comp(43183-45689) 51% to 90C ESTs = AI994541, R30379, R30380

*CYP91A1 now CYP81D1 Complete sequence D78606 no ESTs

*CYP91A2 now CYP81F1 Complete sequence D78607 ESTs: AA394371, T42723, 
AA597575

*CYP91A3 now CYP81D8 Complete sequence ESTs: H76015, T41596, N38687, AA586064

CYP93D1 Complete sequence AB010697 comp(17400-19000 region) no ESTs
GSS: AL088834 BAC T2L17

CYP94B1 Complete sequence AB007649 (comp. 20688-22173) no ESTs
GSS: Al081067 BAC end F2E21

CYP94B2 Complete sequence AB010797 AC011624 AC011664 no ESTs no GSSs

CYP94B3 Clone T08P19 from the EU Chr 3 project comp(10683-12101) 
ESTs AI996574, H76099

CYP94C1 Complete sequence AC005824 no ESTs no GSS 

CYP94D1 missing C-terminal AC023279 18465 - 19850 11-FEB-2000 no ESTs GSS B97734, AL084336 BAC end F8K5 formerly CYP86D1

CYP94D2 AL163972 complete sequence 89747-91303 clone T5P19 

CYP94D3P AC024226 comp(6890-7005) numerous deletions and frameshifts
   GSSs AL080732, AQ010792 formerly CYP86D2P

CYP96A1 Complete sequence AC002391 T20D16.19 (comp. 74934-76484) no ESTs

CYP96A2 Complete sequence AL021811 (F10M6.190) also on AL021636 (F10N7.20) 
no ESTs

CYP96A3 Complete sequence AC004512 no ESTs

CYP96A4 Complete sequence AB019226 no ESTs GSS B96393

CYP96A5 Complete sequence AC007019 F7D8.23 no ESTs no GSS

CYP96A6P pseudogene 62% identical to 96A2 AB025623 missing N-terminal

CYP96A7 complete sequence AC007519 no ESTs no GSSs

CYP96A8 complete sequence AC007519 no ESTs no GSSs

CYP96A9 complete sequence AL078620 54378-55928 F23K16.110

CYP96A10 complete sequence AL078620 57169-58608 F23K16.120

CYP96A11 complete sequence AL078620 comp(58770-60179) F23K16.130

CYP96A12 complete sequence AL078620 comp(60765-62291) F23K16.140

CYP96A13 complete sequence AL162973 69536-71045 clone F9G14 

CYP96A14P Pseudogene fragment AC026480 9579-10061 chr I clone F15E12
GSSs: B20346, B22314

CYP97B3 Complete sequence Z97337.  ESTs: AA040985

CYP97C1 Complete sequence clone T04D02 from the EU Chr 3 project 17165-19444
N-terminal similar to Glycine max EST AI736606 no ESTs

CYP98A3 Complete sequence AC002409 T20B9.5 ESTs: H36469, T43253, Z35213, 
N37715, Z35017, AA728684, AA651162

CYP701A3 Complete sequence AF047719-AF047721 no ESTs GSS: AL087395 BAC 
F14E19

CYP702A1 Complete sequence AC001229 BAC F5I14.20

CYP702A2 Complete sequence Z97338 seq. (a) nucleotides (comp. 95383-97405) 
no ESTs GSS: AL087968 BAC T1A22, AL094730 BAC T13L21

CYP702A3 Complete sequence Z97338 seq. (b) nucleotides 101369-104695 no ESTs

CYP702A4P lone exon sequence Z97338 seq. (d) nucleotides 126846-126941 no ESTs

CYP702A5 Complete sequence Z97338 seq. (h) nucleotides 168806-171661 no ESTs

CYP702A6 Complete sequence Z97338 seq. (i) nucleotides 172246-175058 no ESTs

CYP702A7P lone exon sequence Z97338 seq. (j) nucleotides 176173-176280 no ESTs

CYP702A8 AP001314 comp(11921-14547)

CYP703A2 Complete sequence AC023628 comp(16084-17699) 75% to 703A1 EST AA720028

CYP704A1 Complete sequence AC002388 EST AA597388

CYP704A2 Complete sequence AC003680 F17K2.4 ESTs AA597388
GSS: AL087352 BAC end F14D15

CYP705A1 Complete sequence Z97388 seq. (c)  nucleotides (comp. 116171-117782) 
ESTs T21786

CYP705A2 Complete sequence Z97388 seq. (e)  nucleotides 127652-128588
no ESTs

CYP705A3 Complete sequence Z97388 seq. (f)  nucleotides 134833-136422
no ESTs Also on B97399 BAC end sequence T32J16TF

CYP705A4 Complete sequence Z97388 seq. (g)  nucleotides 153425-155024
genomic sequence X94366 is same gene with some frame shifts. no ESTs

CYP705A5 Complete sequence AB017064 9827-11417 ESTs: T04613, T45789, T43499, 
N97058, T04417

CYP705A6 Complete sequence AC007018 BAC end B97581 no ESTs

CYP705A7X chimeric sequence now = 705A30 and 705A32 
B97148 and B97150 BAC end sequences T32F24TR and 
T32G12TR ESTs T42559, AA395098

CYP705A8 Complete sequence AC005623 no ESTs

CYP705A9 Complete sequence AC005623 no ESTs

CYP705A10P AB017064 comp(81801-81661) lone exon 1 no ESTs

CYP705A11P AB017064 comp(12233-12054) lone exon no ESTs

CYP705A12 Complete sequence AB022210 comp(18214-16643) no ESTs no GSSs

CYP705A13 Complete sequence AC007197 comp(7079-8717) clone T22C12
ESTs T42861, T43276, AA395378

CYP705A14P partial sequence AP000383 amino acids 5-36 followed by a large gap 
then 
414-550 27367-27973

CYP705A15 Complete sequence AP000383 29031-30681 GSS AL009622

CYP705A16 Complete sequence AP000383 32158-33813

CYP705A17P partial sequence AP000383 amino acids 14-271 (222 amino acid gap 
followed by) 494-519 34749-35590

CYP705A18 Complete sequence AP000383 36850-38505

CYP705A19 Complete sequence AP000383 39232-40867 ESTs F19802, F19864

CYP705A20 Complete sequence AP000383 41713-43331 GSS AL088383 no ESTs

CYP705A21 Complete sequence AP000383 44386-46007 GSS AL095325

CYP705A22 Complete sequence AP000383 47200-48831 ESTs T21800, R30233, 
T88278, AI100646

CYP705A23 Complete sequence AP000383 49393-51005

CYP705A24 Complete sequence AC010155 47066-48677 clone F3M18

CYP705A25 AC012561 47417-49106 clone F11F12

CYP705A26P AC012561 49934-50863 pseudogene missing C-terminal clone F11F12

CYP705A27 AC012561 52311-53952 EST W43443 no GSSs clone F11F12

CYP705A28  AP001304 13048-14798 same as AL091537 T7 end of BAC T8C3 = B77649

CYP705A29P AP001304 15786-16553

CYP705A30  AP001304 15786-16553 part of old 705A7X

CYP705A31P AP001304 20651-20824

CYP705A32  AP001304 21561-23630 Identical to B74035 part of old 705A7X

CYP705A33  AP001304 24249-25900 2 amino acid diffs with B96118

CYP706A1 Complete sequence AL021635 T12H17.80 ESTs T46392, T44621, T46193, 
N65907, AA404797
These ESTs could be either 706A1 or 706A2 T21057, T76384, Z24511,
AA395860, AA597583, AA597644, AI138147

CYP706A2 Complete sequence AL021635 T12H17.100 ESTs Z17966, 
These ESTs could be either 706A1 or 706A2 T21057, T76384, Z24511,
AA395860, AA597583, AA597644, AI138147

CYP706A3 Complete sequence AB024024 comp(50063-51694) clone K15C23 no ESTs no 
GSSs

CYP706A4 Complete sequence AL080318 clone T4C9 comp(42111-43787) T4C9.140
GSS AL086483 no ESTs

CYP706A5 Complete sequence AL080318 clone T4C9 comp(44693-46617) T4C9.150
no ESTs no GSSs

CYP706A6 Complete sequence AL080318 clone T4C9 comp(49036-50528) T4C9.160
no ESTs no GSSs

CYP706A7 Complete sequence AL080318 clone T4C9 comp(51874-53756) T4C9.170
no ESTs no GSSs

CYP707A1 Complete sequence AL021687 (T18B16.200) may be a little short EST 
T43171 GSS: AL090955 BAC end T6019 may be T6O19

CYP707A2 Complete sequence AC005315 no ESTS GSS B12307

CYP707A3 Complete sequence AB020744 last 22 amino acids are missing

CYP707A4 Complete sequence AP000419 comp(68986-71501)
clone MVI11 from Kazusa Sept. 3, 1999 GSSs B67654 AND B98253 no ESTs

CYP708A1 Complete sequence AC002304 (33000-35500 region) 32% identical to CYP90
no ESTs

CYP708A2 Complete sequence AB017064 comp(21958-19304) 
ESTs H76703, R90011, T13661, T45729, AA605413, AA713328

CYP708A3 Complete sequence AB007260 16229-18271 ESTs Z34056, Z34880 opposite 
end of Z34056 outside coding region, Z46573

CYP709A1 Complete sequence AB005248 comp(67000-70500) similar to CYP72 
no ESTs

CYP709A2 Complete sequence AC004146 no ESTs

CYP709B1 Complete sequence AC004411 first P450 on cosmid no ESTs

CYP709B2 Complete sequence AC004411 second P450 on cosmid no ESTs

CYP709B3 Complete sequence AL035602 T29A15.200 EST N38616

CYP710A1 Complete sequence AC004077 phase 1 sequence 16000-18000 region
EST T44171, AA395380 also in AC004481

CYP710A2 Complete sequence AC004077 phase 2 sequence comp(25221-26720) 
no ESTs Also in AC004481

CYP710A3 Complete sequence AC005727 no EST no GSS

CYP710A4 Complete sequence AC005727 no EST no GSS

CYP711A1 Complete sequence AC004484 most like mammalian CYP5 may be plant 
homolog of CYP3 clan. No ESTs GSS: AL089622 BAC end T4F8

CYP712A1 Complete sequence AC002561 T24P15.16 comp(38716-39345,39436-40350) 
no ESTs

CYP712A2 Complete sequence AB010697 comp(15190-16802) no ESTs

CYP713A1X and CYP713A2X discontinued see 71A27 and 71A28

CYP714A1 Complete sequence 43500-46500 region AF069716 no ESTs B96503 BAC 
end fragment F23A22TF

CYP714A2 Complete sequence 47000-50000 region AF069716 no ESTs

CYP715A1 Complete sequence AB019226 no ESTs GSS: AL019226 BAC end F6J7

CYP716A1 Complete sequence AB018112 no ESTs no GSSs

CYP716A2 Complete sequence AB018112 no ESTs no GSSs

CYP718 Complete sequence AC006931 no ESTs no GSSs

CYP720 Complete sequence AC012396 comp(80036-82173) 
like CYP90 in the 85 clan 38% to 90A1 but less to 90B1 and 90C1 no ESTs no GSSs

CYP721 complete sequence AC013258 63642-65480 in the 72 clan most like CYP72B
GSSs B20052, B27750

CYP722A1 AC024609 74483-77023, AC025808 35% to 90A1

CYP724A1 AL163817 62148-65132 translation given in Genbank is not correct 
chromosome 5, BAC clone F18O22 gene = F18O22_190 in 85 clan

Unnamed Arabidopsis P450s and an estimate of the lower limit of Arabidopsis P450 genes. Multiple accession numbers indicate overlapping ESTs (contigs).

There are two CYP51 genes

There appear to be at least 17 members in the CYP71A subfamily in Arabidopsis, 
based on distinct overlapping sequences.

B21027 PERF to heme 71B subfamily

B21125 Nterm to C-helix 71B subfamily

AI993108 91% to 71B18

There appear to be at least 37 members in the CYP71B subfamily in Arabidopsis, 
based on 
distinct overlapping sequences.

There are at least 54 members in the 71 family

AI993723 91% to 72A13

AW004264  89% to 72A15

There appear to be at least 12 members in the CYP72 family in Arabidopsis, based 
on 
distinct overlapping sequences.

There is 1 CYP73 family member

There are 2 CYP74 family members

There is at least 1 CYP75 family member

There are at least 5 CYP76 family members

There are at least 4 different CYP77 members in Arabidopsis

There appears to be at least 5 CYP78 members in Arabidopsis.

B19224 79F like 

There are at least 10 members of CYP79 in Arabidopsis

No CYP80 members have been found yet

H77232 same as F14118 probably in the CYP81D subfamily amino acids 207-338

T14177 probably in the CYP81D subfamily

Z26103, Z29010, Z29011 probably in the CYP81 family, subfamily uncertain

AI997093 56% to 81D1 subfamily uncertain

There are at least 17 CYP81 family members in Arabidopsis

There are at least 5 CYP82 family members in Arabidopsis

There are at least 2 CYP83 family members in Arabidopsis

There is one CYP84 family member in Arabidopsis

There appears to be one CYP85 member in Arabidopsis.

There appear to be at least 11 members in the CYP86 family in Arabidopsis, based 
on distinct overlapping sequences.

B08375 87 family 

B10696 87 family differs from B08375

There appears to be at least 3 members in the CYP87 family in Arabidopsis, based 
on 
distinct overlapping sequences.

B11817 CYP88 family

B11581 CYP88 family

There appears to be at least 3 CYP88 members in Arabidopsis

AI992955 93% to 89A5

There are at least 8 members in the CYP89 family in Arabidopsis

B96406, B97796 probably in CYP90 family

B21696 probably in CYP90 family 

There are at least 5 members in the CYP90 family if the BAC ends above are in 
this family

CYP91 was merged with CYP81

CYP92 has no members in Arabidopsis yet

There appears to be at least 1 member of the CYP93 family in Arabidopsis

AL080732 BAC end F1L6 = AQ010792 40% to 94B1

There appears to be at least 3 CYP94 members in Arabidopsis

CYP95 is a discontinued number

AI999275 75% to 96A3

CYP96 has at least 9 members in Arabidopsis

B67502, B26976 probably in the 97 family

AI995768 71% to 97A1

CYP97 has at least 3 members in Arabidopsis

H36457 51% identical to CYP98A3 extreme C-terminal opposite end = AA651146

AL080882 BAC end F1017 = AA651146

CYP98 has at least 3 members

CYP99 is not yet found in Arabidopsis

CYP701 has one member in Arabidopsis

CYP702 has seven members in Arabidopsis

CYP703 has one member in Arabidopsis

AA728483 704 family 54% identical to 704A2

CYP704 has at least 3 members in Arabidopsis

There appears to be at least 33 CYP705 members in Arabidopsis

CYP706 has 3 members in Arabidopsis

CYP707 has at least 5 members in Arabidopsis

CYP708 has at least 6 members in Arabidopsis

CYP709 has 5 members

CYP710 has 4 members

CYP711 has 1 member

CYP712 has 2 members 

CYP713 merged with 71A as 71A27 and 71A28

CYP714 has 2 members

CYP715 has 1 member

CYP716 has 2 members

CYP717 has been joined with CYP81 = CYP81J1

CYP718 has 1 member

CYP719 has not been seen in Arabidopsis yet

CYP720 has 1 member

CYP721 has 1 member

CYP722 has 1 member