P450s that have appeared since the 1993 P450 nomenclature update.
This is part A of the list covering CYP1 to CYP2
This includes references that were incomplete and duplications
of sequences that were already in the update. If a sequence
is assigned an accession number that was not in the old update
it is included in this list.
This list was last revised on Jan. 31, 2003.
Added all human genes and pseudogenes
Compiled by David R. Nelson
A new format is being designed to make the entries more useful, with links to
Genbank and Medline and access to the protein sequence. As time permits the
entries in the 1993 P450 Nomenclature Update will be added to make the
listing more comprehensive. For the time being, I will leave the old text
format in place below the newer table format, but eventually the text version
will be deleted. Any comments are welcome.
1A Subfamily
1B Subfamily
2A Subfamily
2B Subfamily
2C Subfamily
2D Subfamily
2E Subfamily
2F Subfamily
2G Subfamily
2H Subfamily
2J Subfamily
2K Subfamily
2L Subfamily
2M Subfamily
2N Subfamily
2P Subfamily
2Q Subfamily
|
Cytochrome P450 Data CYP1 to CYP2 (Under Construction) |
||||||
|
|
|
|||||
|
P450 gene |
Species |
Medline Entry |
Comment |
Protein Sequence |
Genbank Accession |
|
|
|
|
|||||
|
CYP1A1 |
human |
none |
3' UTR |
D12525 D01198 |
|
|
|
CYP1A1 |
human |
none |
3' UTR |
D12525 D01198 |
|
|
|
CYP1A1 |
human |
none |
3' UTR |
D12525 D01198 |
|
|
|
CYP1A1 |
human |
none |
5' UTR |
D10855 D01150 |
|
|
|
CYP1A1 |
human |
none |
5' UTR |
D10855 D01150 |
|
|
|
CYP1A1 |
Cavia cobaya |
none |
D11043 PIR S43414 |
|
||
|
|
|
|||||
|
|
||||||
1A Subfamily
CYP1A1 human
GenEMBL D12525 D01198 (650bp)
Kawajiri,K., Watanabe,J., Gotoh,O., Tagashira,Y., and Sogawa,K.
Structure and drug inducibility of the human cytochrome P-450c
gene.
Eur. J. Biochem. 159, 219-225 (1986)
Kubota,M., Sogawa,K., Kaizu,Y., Sawaya,T., Watanabe,J.,
Kawajiri,K., Gotoh,O. and Fujii-Kuriyama,Y.
Xenobiotic responsive element in the 5'-upstream region
of the human P-450c gene.
J. Biochem. 110, 232-236 (1991)
Hayashi,S.-i., Watanabe,J., Nakachi,K. and Kawajiri,K.
Genetic linkage of lung cancer-associated MspI polymorphisms
with amino acid replacement in the heme binding region of
the human cytochrome P450IA1 gene.
J. Biochem. 110, 407-411 (1991)
CYP1A1 human
GenEMBL D10855 D01150 (4144bp)
Kawajiri,K., Watanabe,J., Gotoh,O., Tagashira,Y., and Sogawa,K.
Structure and drug inducibility of the human cytochrome P-450c
gene.
Eur. J. Biochem. 159, 219-225 (1986)
Kubota,M., Sogawa,K., Kaizu,Y., Sawaya,T., Watanabe,J.,
Kawajiri,K., Gotoh,O. and Fujii-Kuriyama,Y.
Xenobiotic responsive element in the 5'-upstream region
of the human P-450c gene.
J. Biochem. 110, 232-236 (1991)
Note: these refs are the same as the two earlier accession numbers.
CYP1A1 Cavia Cobaya (guinea pig)
GenEMBL D11043 (2674bp)
PIR S43414 (516 amino acids)
Ohgiya,S. Ishizaki,K. and Shinriki,N.
Molecular cloning of guinea pig CYP1A1: complete primary structure
and fast mobility of expressed protein on electrophoresis.
Biochim. Biophys. Acta 1216, 237-244 (1993)
CYP1A1 rat
GenEMBL I00732 (1800bp)
Oeda,K., Sakaki,T., Ohkawa,H., Yabusaki,Y., Murakami,H.,
Nakamura,K. and Shimizu,M.
Cytochrome P-450MC gene, expression plasmid carrying the said gene,
yeasts transformed with the said plasmid and a process for producing
cytochrome P-450MC by culturing the said transformant yeasts.
Patent: US 4766068-A 1 23-AUG-1988
CYP1A1 rat
PIR A93513 (524 amino acids)
Yabusaki, Y., Shimizu, M., Murakami, H., Nakamura, K., Oeda,
K. and Ohkawa, H.
Nucleotide sequence of a full-length cDNA coding for
3-methylcholanthrene-induced rat liver cytochrome P-450MC.
Nucleic Acids Res. 12, 2929-2938 (1984)
CYP1A1 rat
PIR S45716 (524 amino acids)
Omata, Y., Robinson, R.C., Gelboin, H.V., Pincus, M.R.,
Friedman, F.K.
Specificity of the cytochrome P-450 interaction with
cytochrome b(5).
FEBS Lett. 346, 241-245 (1994)
CYP1A1 rat
PIR D60822 (19 amino acids)
Amelizad, Z., Narbonne, J.F., Wolf, C.R., Robertson, L.W. and
Oesch, F.
Effect of nutritional imbalances on cytochrome P-450 isozymes
in rat liver.
Biochem. Pharmacol. 37, 3245-3249 (1988)
CYP1A1 hamster
GenEMBL D10913 (8700bp) Swiss Q00557 (524 amino acids)
Sagami,I., Ohmachi,T., Fujii,H., Kikuchi,H. and Watanabe,M.
Hamster cytochrome P-450 IA gene family, P-450IA1 and P-450IA2 in
lung and liver: cDNA cloning and sequence analysis
J. Biochem. 110, 641-647 (1991)
CYP1A1 hamster
PIR JS0746 (524 amino acids)
Ohgiya, S., Goda, T., Ishizaki, K., Morimoto, M., Sakamoto,T.,
Kamataki, T. and Shinriki, N.
unpublished (1992)
CYP1A1 rabbit
PIR A25143 (464 amino acids)
Okino, S.T., Quattrochi, L.C., Barnes, H.J., Osanto, S.,
Griffin, K.J., Johnson, E.F. and Tukey, R.H.
Cloning and characterization of cDNAs encoding 2,3,7,
8-tetrachlorodibenzo-p-dioxin-inducible rabbit mRNAs for
cytochrome P-450 isozymes 4 and 6.
Proc. Natl. Acad. Sci. U.S.A. 82, 5310-5314 (1985)
CYP1A1 Macaca irus (crab eating macaque monkey)
GenEMBL D17575 (2602bp)
Ohmachi,T., Sagami,I., Kikuchi,H., Fujii,H., Suzaki,Y., Fujiwara,T.
and Watanabe,M.
Molecular cloning and sequence analysis of cDNA encoding a
crab-eating monkey (Macaca irus) cytocrome P-450
unpublished (1993)
CYP1A1 Macaca fasicularis (crab eating macaque monkey)
Swiss P33616 (512 amino acids)
Komori, M. Kikuchi,O. Kitada,M. Kamataki T.
Molecular cloning of monkey 1A1 cDNA and expression in yeast.
Biochim. Biophys. Acta 1131, 23-29 (1992)
CYP1A1 Sus scrofa (pig)
No accession number
Misaki Kojima
Submitted to nomenclature committee Oct. 27, 2000
82% to human CYP1A1, 74% to human 1A2
CYP1A1 Macropus eugenii (tamar wallaby)
no accession number
Ross McKinnon
submitted to nomenclature committee 9/7/98
98 amino acid C-terminal fragment is 82% identical to macaque 1A1
CYP1A1 Balaenoptera acutorostrata (Minke whale)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee
CYP1A1 Phocoenoides dalli (Dall's porpoise)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee
CYP1A1 Eumetopias jubatus (Steller sea lion)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
clone #1
submitted to nomenclature committee
CYP1A1 Phoca largha (Spotted seal)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee
CYP1A1 Phoca fasciata (Ribbon seal)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee 6/29/99 revised 2/27/01
CYP1A1 Halichoerus grypus (grey seal, gray seal)
No accession number
Rachel Tilley
Submitted to nomenclature committee 3/19/2001
Name grey seal 1
CYP1A1 Phoca groenlandica (harp seal)
No accession number
Rachel Tilley
Submitted to nomenclature committee 3/19/2001
Name harp seal 1
Cyp1a1 mouse
GenEMBL K02588 (2619bp)
Kimura,S., Gonzalez,F.J. and Nebert,D.W.
The murine Ah locus.
J. Biol. Chem. 259, 10705-10713 (1984)
Cyp1a1 mouse
GenEMBL M10021 (8809bp)
PIR A24953 (30 amino acids)
Gonzalez,F.J., Mackenzie,P.I., Kimura,S. and Nebert,D.W.
Isolation and characterization of full-length mouse cDNA and
genomic clones of 3-methylcholanthrene-inducible cytochrome
P-1-450 and P-3-450
Gene 29, 281-292 (1984)
Cyp1a1 mouse
GenEMBL X01681 (6214bp)
Kimura,S., Gonzalez,F.J. and Nebert,D.W.
The murine Ah locus: Comparison of the complete cytochrome P1-450
and P3-450 cDNA nucleotide and amino acid sequences
J. Biol. Chem. 259, 10705-10713 (1984)
Cyp1a1 mouse
GenEMBL M11515 (8850bp)
Kimura,S. and Nebert,D.W.
Comparison of the mouse P-1-450 gene and flanking sequences from a
MOPC 41 plasmacytoma and normal liver.
DNA 4, 365-375 (1985)
Cyp1a1 mouse
GenEMBL M25623 (410bp)
Peterson,T.C., Gonzalez,F.J. and Nebert,D.W.
Methylation differences in the murine P-1-450 and P-3-450 genes in
wild-type and mutant hepatoma cell culture
Biochem. Pharmacol. 35, 2107-2114 (1986)
Cyp1a1 mouse
GenEMBL M33935 (474bp)
Jones,J.E. and Nebert,D.W.
Transcriptional start site in the mouse Cyp1a1 (cytochrome P-1-450) gene.
DNA 8, 527-534 (1989)
Cyp1a1 mouse
PIR C24406 (24 amino acids)
Cheng, K.C., Park, S.S., Krutzsch, H.C., Grantham, P.H.,
Gelboin, H.V. and Friedman, F.K.
Amino-terminal sequence and structure of monoclonal antibody
immunopurified cytochromes P-450.
Biochemistry 25, 2397-2402 (1986)
CYP1A1 Ovis aries (sheep)
GenEMBL S79795 (2585bp)
Hazinski,T.A., Noisin,E., Hamon,I. and DeMatteo,A.
Sheep lung cytochrome P4501A1 (CYP1A1): cDNA cloning and
transcriptional regulation by oxygen tension
J. Clin. Invest. 96 (4), 2083-2089 (1995)
CYP1A2 human
GenEMBL M38504 (3149bp)
Jaiswal,A.K., Nebert,D.W., McBride,W.O. and Gonzalez,F.J.
Human P-3-450: cDNA and complete protein sequence, repetitive Alu
sequences in the 3' nontranslated region, and localization of gene
to chromosome 15
J. Exp. Pathol. 3, 1-17 (1987)
CYP1A2 human
GenEMBL U02993 (3293bp)
Quattrochi,L.C. and Tukey,R.H.
The human cytochrome Cyp1A2 gene contains regulatory elements
responsive to 3-methylcholanthrene
Mol. Pharmacol. 36, 66-71 (1989)
CYP1A2 human
PIR A25892 (515 amino acids)
Quattrochi, L.C., Pendurthi, U.R., Okino, S.T., Potenza, C. and
Tukey, R.H.
Human cytochrome P-450 4 mRNA and gene: part of a multigene
family that contains Alu sequences in its mRNA.
Proc. Natl. Acad. Sci. U.S.A. 83, 6731-6735 (1986)
CYP1A2 human
PIR A60881 (18 amino acids)
Wrighton, S.A., Campanile, C., Thomas, P.E., Maines, S.L.,
Watkins, P.B., Parker, G., Mendez-Picon, G., Haniu, M.,
Shively, J.E., Levin, W. and Guzelian, P.S.
Identification of a human liver cytochrome P-450 homologous
to the major isosafrole-inducible cytochrome P-450 in the rat.
Mol. Pharmacol. 29, 405-410 (1986)
CYP1A2 rabbit
PIR B27821 (516 amino acids)
Kagawa, N., Mihara, K., Sato, R.
Structural analysis of cloned cDNAs for polycyclic
hydrocarbon-inducible forms of rabbit liver microsomal
cytochrome P-450.
J. Biochem. 101, 1471-1479 (1987)
CYP1A2 dog
PIR A60463 (16 amino acids)
Ohta, K., Motoya, M., Komori, M., Miura, T., Kitada, M. and
Kamataki, T.
A novel form of cytochrome P-450 in beagle dogs. P-450-D3 is
a low spin form of cytochrome P-450 but with catalytic and
structural properties similar to P-450d.
Biochem. Pharmacol. 38, 91-96 (1989)
CYP1A2 rat
PIR B24406 (25 amino acids)
Cheng, K.C., Park, S.S., Krutzsch, H.C., Grantham, P.H.,
Gelboin, H.V. and Friedman, F.K.
Amino-terminal sequence and structure of monoclonal antibody
immunopurified cytochromes P-450.
Biochemistry 25, 2397-2402 (1986)
CYP1A2 rat
GenEMBL X01031 (1106bp) PIR A44612 (367 amino acids)
Yabusaki, Y., Murakami, H., Nakamura, K., Nomura, N.,
Shimizu, M., Oeda, K. and Ohkawa, H.
Characterization of complementary DNA clones coding for two
forms of 3-methylcholanthrene-inducible rat liver
cytochrome P-450.
J. Biochem. 96, 793-804 (1984)
CYP1A2 rat
PIR S26822 (19 amino acids)
Botelho, L.H., Ryan, D.E., Yuan, P.M., Kutny, R., Shively,
J.E. and Levin, W.
Amino-terminal and carboxy-terminal sequence of hepatic
microsomal cytochrome P-450d, a unique hemoprotein from
rats treated with isosafrole.
Biochemistry 21, 1152-1155 (1982)
CYP1A2 rat
PIR D60822 (22 amino acids)
Amelizad, Z., Narbonne, J.F., Wolf, C.R., Robertson, L.W. and
Oesch, F.
Effect of nutritional imbalances on cytochrome P-450 isozymes
in rat liver.
Biochem. Pharmacol. 37, 3245-3249 (1988)
CYP1A2 rat
PIR A61400 (513 amino acids)
Woelfel, C.; Platt, K.L.; Dogra, S.; Glatt, H.; Waechter, F.;
Doehmer, J.
Stable expression of rat cytochrome P450IA2 cDNA and
hydroxylation of 17beta-estrodiol and 2-aminofluorene in
V79 Chinese hamster cells.
Mol. Carcinog. 4, 489-498 (1991)
CYP1A2 hamster
GenEMBL D10914 (9719bp)
Sagami,I., Ohmachi,T., Fujii,H., Kikuchi,H. and Watanabe,M.
Hamster cytochrome P-450 IA gene family, P-450IA1 and P-450IA2 in
lung and liver: cDNA cloning and sequence analysis
J. Biochem. 110, 641-647 (1991)
CYP1A2 Mesocricetus auratus (hamster)
GenEMBL M63787 M34446 (1868bp)
Lai,T.S. and Chiang, J.Y.L.
Cloning and characterization of two major 3-methylcholanthrene inducible hamster
liver cytochrome P-450s.
Arch. Biochem Biophys. 283, 429-439 (1990)
clone MC4
note: M34446 is incorrectly included in the GenBank entry
for CYP2A8 and CYP2A9. M34446 should only be in the CYP1A2 hamster entry.
CYP1A2 Cavia cobaya (guinea pig)
GenEMBL D50457 (1760bp)
Mori,T., Itoh,S., Ohgiya,S., Ishizaki,K. and Kamataki,T.
Effect of ascorbic acid on expression of several forms of
cytochrome P-450 of guinea pig
Unpublished (1995)
CYP1A2 Cavia porcellus (guinea pig)
GenEMBL U23501 (1757bp)
Black,V.H.
unpublished 1995
CYP1A2 chicken
GenEMBL M64537 (884bp)
Swiss Q01741 (258 amino acids)
Murti,J.R., Adiga,P.R. and Padmanaban,G.
Estradiol-17-Beta induces polyaromatic hydrocarbon-inducible
cytochrome p-450 in chicken liver
Biochem. Biophys. Res. Commun. 175, 928-935 (1991)
Note: previously called 1A2
CYP1A2 Eumetopias jubatus (Steller sea lion)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
clone #2
submitted to nomenclature committee
CYP1A2 Phoca fasciata (Ribbon seal)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee 6/28/99 revised 2/27/01
CYP1A1/CYP1A2 chimera Phoca fasciata (Ribbon seal)
no accession number
Ikuko Teramitsu, Yukio Yamamoto, and Shoichi Fujita
submitted to nomenclature committee 6/28/99
on 2/27/01 the authors sent the following message
"... we believe that the production of the chimera
sequence could be the result of a PCR defect."
CYP1A2 Halichoerus grypus (grey seal, gray seal)
No accession number
Rachel Tilley
Submitted to nomenclature committee 3/19/2001
Name grey seal 2
CYP1A2 Phoca groenlandica (harp seal)
No accession number
Rachel Tilley
Submitted to nomenclature committee 3/19/2001
Name harp seal 2
Cyp1a2 mouse
GenEMBL K02589 (1893bp)
Kimura,S., Gonzalez,F.J. and Nebert,D.W.
The murine Ah locus.
J. Biol. Chem. 259, 10705-10713 (1984)
Cyp1a2 mouse
PIR A93512 (513 amino acids)
Kimura, S., Gonzalez, F.J. and Nebert, D.W.
Mouse cytochrome P-3-450: complete cDNA and amino acid
sequence.
Nucleic Acids Res. 12, 2917-2928 (1984)
Cyp1a2 mouse
GenEMBL X01682 (6715bp)
Kimura,S., Gonzalez,F.J. and Nebert,D.W.
The murine Ah locus: Comparison of the complete cytochrome P1-450
and P3-450 cDNA nucleotide and amino acid sequences
J. Biol. Chem. 259, 10705-10713 (1984)
Cyp1a2 mouse
GenEMBL M25624 (510bp)
Peterson,T.C., Gonzalez,F.J. and Nebert,D.W.
Methylation differences in the murine P-1-450 and P-3-450 genes in
wild-type and mutant hepatoma cell culture
Biochem. Pharmacol. 35, 2107-2114 (1986)
Cyp1a2 mouse
PIR B92495 (513 amino acids)
Gonzalez, F.J., Kimura, S. and Nebert, D.W.
J. Biol. Chem. 260, 11884-11889 (1985)
Erratum
Cyp1a2 mouse
GenEMBL M10022 (8865bp)
PIR B24953 (30 amino acids)
Gonzalez,F.J., Mackenzie,P.I., Kimura,S. and Nebert,D.W.
Isolation and characterization of full-length mouse cDNA and
genomic clones of 3-methylcholanthrene-inducible cytochrome
P-1-450 and P-3-450
Gene 29, 281-292 (1984)
Cyp1a2 mouse
PIR A45955 (42 amino acids) PIR B45955 (39 amino acids)
Peterson, T.C., Gonzalez, F.J. and Nebert, D.W.
Methylation differences in the murine P-1-450 and P-3-450
genes in wild-type and mutant hepatoma cell culture.
Biochem. Pharmacol. 35, 2107-2114 (1986)
Cyp1a2 mouse
PIR D24406 (25 amino acids) PIR E24406 (25 amino acids)
Cheng, K.C., Park, S.S., Krutzsch, H.C., Grantham, P.H.,
Gelboin, H.V. and Friedman, F.K.
Amino-terminal sequence and structure of monoclonal antibody
immunopurified cytochromes P-450.
Biochemistry 25, 2397-2402 (1986)
Fish Cytochrome P450s are undergoing a revision to their nomenclature. Initially
there appeared to be just one fish 1A gene per species, but that is not true as shown
by Amy Berndtson in trout. Until an adequate nomenclature can be devised, these fish
sequences are listed as CYP1A, without a number following the subfamily. This does
not affect the mammalian gene designations, though it may affect the chicken
sequences.
CYP1A1 Oncorhynchus mykiss (trout)
GenEMBL S69278 (5023bp)
Berndtson,A.K. and Chen,T.T.
Two unique CYP1 genes are expressed in response to
3-methylcholanthrene treatment in rainbow trout.
Arch. Biochem. Biophys. 310, 187-195 (1994)
Note: published as CYP1A2, but it is more similar to Heilmann's sequence
than Berndtson's 1A1 (97.9% identical).
CYP1A1 Oncorhynchus mykiss (trout)
GenEMBL U62797(1697bp)
Bailey,G., You,L. and Harttig,U.
Cloning, sequencing and functional expression of two trout CYP1A
cDNAs in yeast
unpublished (1997)
incorrectly called 1A2
CYP1A3 Oncorhynchus mykiss (trout)
GenEMBL U62796(2401bp)
Bailey,G., You,L. and Harttig,U.
Cloning, sequencing and functional expression of two trout CYP1A
cDNAs in yeast
unpublished (1997)
incorrectly called 1A1
CYP1A Oncorhynchus mykiss (trout)
GenEMBL AF015660
Bailey,G., You,L. and Harttig,U.
Cloning,sequencing and aflatoxin B1 metabolism by multiple rainbow
trout CYP1A cDNAs expressed in yeast
Unpublished
8 amino acid differences with U62797
CYP1A3 Oncorhynchus mykiss (trout)
GenEMBL S69277 (5524bp)
Berndtson,A.K. and Chen,T.T.
Two unique CYP1 genes are expressed in response to
3-methylcholanthrene treatment in rainbow trout.
Arch. Biochem. Biophys. 310, 187-195 (1994)
Note: published as CYP1A1. This sequence is 96.7% identical to
Heilmann's 1A1 sequence.
CYP1A1/CYP1A3 chimera Oncorhynchus mykiss (trout)
PIR A28789 (522 amino acids)
Heilmann, L.J., Sheen, Y.Y., Bigelow, S.W. and Nebert, D.W.
Trout P450IA1: cDNA and deduced protein sequence, expression
in liver, and evolutionary significance.
DNA 7, 379-387 (1988)
Published as CYP1A1
note: subsequent analysis has shown that the 5' end of this sequence
comes from the 1A3 gene and the switch over occurs between base 271
and base 435 with base 1 as the A of the ATG start codon.
CYP1A Pleuronectes platessa (plaice, a fish)
GenEMBL X73631 (2411bp) PIR S34184 (521 amino acids)
Leaver,M.J., Pirrit,L. and George,S.G.
Cytochrome P450 1A1 cDNA from plaice (Pleuronectes platessa)
Mol. Marine Biol. Biotechnol. 2, 338-345 (1993)
CYP1A Opsanus tau ( oyster toadfish)
GenEMBL U14161 (2352bp)
Morrison, H.G., Oleksiak, M.F., Cornell, N.W., Sogin,M.L. and
Stegeman, J.J.
Identification of Cytochrome P450 1A genes from two teleost fish, toadfish
(Opsanus tau) and scup (Stenotomus chrysops), and pyhlogenetic analysis
of CYP1A genes.
Biochem. J. 308, 97-104 (1995)
CYP1A Stenotomus chrysops (scup, a fish)
GenEMBL U14162 (1566bp)
Morrison, H.G., Oleksiak, M.F., Cornell, N.W., Sogin,M.L. and
Stegeman, J.J.
Identification of Cytochrome P450 1A genes from two teleost fish, toadfish
(Opsanus tau) and scup (Stenotomus chrysops), and pyhlogenetic analysis
of CYP1A genes.
Biochem. J. 308, 97-104 (1995)
CYP1A Chaetodon capistratus (four-eye butterfly fish)
GenEMBL U19855 (2552bp)
Vrolijk,N.H., Lin,C. and Chen,T.T.
Characterization and expression of a CYP1A gene from the tropical
teleost, Chaetodon capistratus.
Unpublished 1995
CYP1A Dicentrarchus labrax (european sea bass)
GenEMBL U78316(1563bp)
Stien,X., Amichot,M., Berge,J.-B. and Lafaurie,M.
Molecular cloning of a CYP1A cDNA from the teleost fish
Dicentrarchus labrax.
Unpublished (1995)
CYP1A1v2 Dicentrarchus labrax (european sea bass)
No accession number
Alessandra Salvetti
Submitted to nomenclature committee 11/26/99
94% identical to U78316 probably an allele
CYP1A Microgadus tomcod (Atlantic tomcod)
GenEMBL L41886 (2497bp) L41917
Roy,N.K., Konkle,B.A., Kreamer,G.-L., Grunwald,C. and Wirgin,I.I.
Characterization and prevalence of a polymorphism in the 3'
untranslated region of cytochrome P4501A1 in cancer-prone Atlantic tomcod
Arch. Biochem. Biophys. (1995) In press
probable frameshift detected by O. Gotoh. in the beginning of the sequence.
CYP1A Microgadus tomcod (Atlantic tomcod)
GenEMBL L41917 (6837bp)
Roy,N.K., Konkle,B. and Wirgin,I.I.
Functional characterization of Cytochrome P4501A1 regulatory
sequences in cancer-prone Atlantic tomcod.
Unpublished (1995)
CYP1A Pagrus major (wild red sea bream)
no accession number
Mizukami,M., Okauchi,M., Ariyoshi,T. and Kito,H.
The isolation and sequence of cDNA encoding a 3-methylcholanthrene-
inducible cytochrome P450 from wild red sea bream, Pagrus major.
Marine Biol. 120, 343-349 (1994)
CYP1A Sparus aurata (gilthead sea bream)
GenEMBL AF011223, AF005719
CYP1A Liza aurata
GenEMBL AF022433
Cousinou,M., Lopez-Barea,J. and Dorado,G.
CYP1A Liza saliens (leaping mullet)
GenEMBL AF072899
Alaattin Sen and Don Buhler
submitted to nomenclature committee
96% identical to Liza aurata
CYP1A Limanda limanda
GenEMBL AJ001724
Robertson,F.E., McPhail,M.E., Rankin,R., Stagg,R.M. and Craft,J.A.
CYP1A Platichthys flesus (European flounder)
GenEMBL AJ132353
Williams,T.D., Lee,J.S. and Chipman,J.K.
The cytochrome P450 1A gene (CYP1A) from European flounder
(Platichthys flesus), analysis of regulatory regions and
development of a dual luciferase reporter gene assay.
Unpublished
CYP1A1 Salmo salar (salmon)
No accession number
Christopher Rees Weiming Li
submitted to nomenclature committee Nov. 9, 2001
a second gene is being isolated so this is called 1A1
rather than just CYP1A. This does not imply orthology to the
mammalian 1A1, 1A2. The CYP1A gene duplications in fish and mammals
occurred independently.
CYP1A4 Gallus gallus (chicken)
GenEMBL X99453(2098bp)
Gilday,D.J., Gannon,M., Yutzey,K., Bader,D. and Rifkind,A.
Molecular cloning and expression of two novel avian cytochrome P450
1A enzymes induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin.
J. Biol. Chem. 271, 33054-33059 (1996)
CYP1A5 Gallus gallus (chicken)
GenEMBL X99454(1845bp)
Gilday,D.J., Gannon,M., Yutzey,K., Bader,D. and Rifkind,A.
Molecular cloning and expression of two novel avian cytochrome P450
1A enzymes induced by 2,3,7,8-tetrachlorodibenzo-p-dioxin.
J. Biol. Chem. 271, 33054-33059 (1996)
CYP1A6 Xenopus laevis (African clawed frog)
GenEMBL AB022087
Fujita,Y. and Ohi,H.
Xenopus laevis mRNA for cytochrome P450, cDNA clone MC1
unpublished(1999) In press
clone MC1
CYP1A7 Xenopus laevis (African clawed frog)
GenEMBL AB022088
Fujita,Y. and Ohi,H.
Xenopus laevis mRNA for cytochrome P450, cDNA clone MC2
unpublished(1999) In press
clone MC2
CYP1A8P human
NT_008580.9
Pseudogene 43% identcal to 1A2 human
NT_008580.9|Hs9_8737 chromosome 9
4822084 MILDLAVTPGEVTTSLIILVMVFVFVRALRSKGRKQVSPPGP*SFPIIENLLQLGDHPY 4822260
4822261 LTLMEMRKKYGDVFLLKLGMVPVLVVNGMEMVKQVLHKDGEHFAGRPNMHTFSFLAEGKS 4822440
4822441 LSFSVNYGESWKLHKKIASKAL*TFSNAEAKSSTCSCSLEEHVTEEISELVTVFVELTSK 4822620
4822621 NGSFDPRNAITCVVANIVCALCFGKR*DHSDEEFLRIVKTNDDLLKASSAANPADFIPCL 4822800
4822801 HYLPLKIINAPLEFYQALNGFIALHVQDHLATYGK 4822905 (0)
4824790 DHIRDITDALINVCHNKYAATKTDTLNDSEIISTVSDLFGA 4824912 (1)
4829424 GFETVSTCLCWSFLYLIHYPEIQARIQEEI 4829513 (1)
4829611 RPPRFEDRKILPYTEAFVSEVFRHASFLPFTIPHS 4829715 (2)
4832677 TTADTTLNGYFIPRKTCTFINMYQVNHDE 4832763 (2)
4835676 TIWDNHSLFRPDRFLNENRELNKSLVEKVLIFGMGIRKCLGEDVARNEIFIFITTVLQQFK 4835858
4835859 LKK*PRAKLDLTPTYGLVMRPKLYQLQAELHPSGSSSA* 4835975
1B Subfamily
CYP1B1 human
GenEMBL U03688 (5102bp)
Sutter,T.R., Tang,Y.M., Hayes,C.L., Wo,Y.-Y.P., Jabs,E.W.,
Li,X., Yin,H., Cody,C.W. and Greenlee,W.F.
Complete cDNA sequence of a human dioxin-inducible mRNA
identifies a new gene subfamily of cytochrome P450 that maps to
chromosome 2.
J. Biol. Chem. 269, 13092-13099 (1994)
*** Note The CYP1B1 gene has been linked to primary congenital glaucoma****
See April 97 Human Molecular Genetics
CYP1B1 human
GenEMBL U56438 (12177bp)
Tang,Y.M., Wo,Y.-Y.P., Stewart,J., Hawkins,A.L., Griffin,C.A.,
Sutter,T.R. and Greenlee,W.F.
Isolation and characterization of the human cytochrome P450 CYP1B1
gene.
J. Biol. Chem. 271, 28324-28330 (1996)
CYP1B1 rat
GenEMBL X83867 (2321bp)
Battacharyya,K.K., Brake,P.B., Eltom,S.E., Otto,S.A. and Jefcoate,C.R.
Identification of a rat adrenal cytochrome P450 active in polycyclic hydrocarbon
metabolism as a rat CYP1B1. Demonstration of a unique tissue-specific pattern of
hormonal and aryl; hydrocarbon receptor-linked regulation.
J. Biol. Chem. 270 11595-11602 (1995)
CYP1B1 rat
GenEMBL U09540(4964bp)
Nigel Walker
Walker,N.J., Gastel,J.A., Costa,L.T., Clark,G.C., Lucier,G.W. and
Sutter,T.R.
Rat CYP1B1: an adrenal cytochrome P450 that exhibits sex-dependent
expression in livers and kidneys of TCDD-treated animals.
Carcinogenesis 16 (6), 1319-1327 (1995)
Cyp1b1 mouse
GenEMBL U02479 (317bp)
Shen,Z., Wells,R., Liu,J. and Elkind,M.M.
Identification of a cytochrome P450 gene by reverse transcription-
PCR using degenerate primers containing inosine.
Proc. Natl. Acad. Sci. USA 90, 11483-11487 (1993)
Note: only 104 amino acids by PCR.
Cyp1b1 mouse
GenEMBL U03283 (5128bp)
Shen,Z., Liu,J., Wells,R.L. and Elkind,M.M.
cDNA cloning, sequence analysis, and induction by aryl hydrocarbons
of a murine cytochrome P450 gene, Cyp1b1.
DNA Cell Biol. 13, 763-769 (1994)
Cyp1b1 mouse
GenEMBL X78445 (2006bp)
Savas,U., Bhattacharyya,K.K., Christou,M., Alexander,D.L. and
Jefcoat,C.R.
Mouse cytochrome P450EF, representative of a new 1B subfamily of
cytochrome P450s. Cloning, sequence determination, and tissue
expression.
J. Biol. Chem. 269, 14905-14911 (1994)
CYP1B Fundulus heteroclitus (killifish)
No accession number
Celine Godard, Maya Said and John Stegeman
Submitted to nomenclature committee Feb. 16, 2000
CYP1B Danio rerio (zebrafish)
No accession number
Celine Godard, Maya Said and John Stegeman
Submitted to nomenclature committee Feb. 16, 2000
CYP1B1 Stenella coeruleoalba (striped dolphin)
no accession number
Celine Godard, Maya Said and John Stegeman
submitted to nomenclature committee Nov. 20, 1998
PCR fragment 90% identical to human 1B1 I-helix to PERF motif region
CYP1B1 Pleuronectes platessa (plaice)
no accession number
Michael Leaver
submitted to Nomenclature Committee 3/11/99
full length seq.
CYP1B2X Stenotomus chrysops (scup, a fish)
no accession number
Celine Godard, Maya Said, and John Stegeman.
submitted to nomenclature committee full length 4/21/99
81% identical to scup 1B3
renamed CYP1C1
CYP1B3X Stenotomus chrysops (scup, a fish)
no accession number
Celine Godard, Maya Said, and John Stegeman.
submitted to nomenclature committee Aug. 26, 1998 full length 4/21/99
63% identical to human 1B1 over C-terminal PCR fragment
I-helix to heme
formerly 1B1, reaassigned to CYP1C2
CYP1C1 Stenotomus chrysops (scup, a fish)
no accession number
Celine Godard, Maya Said, and John Stegeman.
submitted to nomenclature committee full length 4/21/99
81% identical to scup 1C2
formerly 1B2, reaassigned after consultation with the submitters
and comparison to the Fugu genomic orthologs (see below)
CYP1C1 Fugu rubripes
No accession number
Scaffold_3008b comp(8676-10253) no introns complete gene
86% to scup 1C1 75% to scup 1C2
10253 MALDTEFGVKSSSITREWSGQVQPALVASFLFLFCLEACLWVRNLRHKRRL
10100 PGPFAWPVVGNAMQLGQMPHITFAKLAKKYGNVYQIRLGCSNI 9972
9971 VVLNGDQAIHQALIEHSTEFAGRPNFVSFQMISGGRSLTFTNYSKQWKVHRKLAQSSLRA 9792
9791 FSSANKQTKIAFEQHVTAEANELVQAFLRYSTDGRYFDPAHEFTVAAANVMCALCFGKRY 9612
9611 GHDDHEFRCLLKKLNKFGETVGAGSLVDVMPWLQSFPNPVRSLYENFKSLNEEFFNFV 9438
9437 KNKVQEHRESFDPNVTRDMSDAMINVIEERKDGTLSKEFAEATITDLIGAGQDTVS 9270
9269 TVLQWIVLLLVKHPDKQAKLHELMDKVVGQDRLPTTEDRSSLAYLDAFIYETMRFTSFVP 9090
9089 VTIPHSTTSDVTIEGLRIPKDTVVFINQWSVNHDPLKWKDPHVFDPSRFLNENGDLNKDL 8910
8909 TSGVMIFSSGKRRCIGSQIAKVEVFLFAAILLHQCSFESDPSDPLTLDCSYGLTLKP 8739
LRCFVSAKPRGKLLGLVSPA* 8676
CYP1C2 Stenotomus chrysops (scup, a fish)
no accession number
Celine Godard, Maya Said, and John Stegeman.
submitted to nomenclature committee Aug. 26, 1998 full length 4/21/99
63% identical to human 1B1 over C-terminal PCR fragment
I-helix to heme
formerly 1B3, reaassigned after consultation with the submitters
and comparison to the Fugu genomic orthologs (see below)
CYP1C2 Fugu rubripes
No accession number
Scaffold_3008a comp(5208-6770) no introns complete gene
83% to scup 1C2 78% to scup 1C1
6770 MGXDFGLKXSSSITREWSGHVQPALVAFFVFLFCVEACLWAKNLKRRL
6626 PGPFAWPVVGNAMQLGQMPHITFSKLAKKYGNVYQIRLGCSDI 6498
6497 VVLNGARVIRQALIEHSTEFAGRPNFVSFQNVSGGKSMAFTSYSKQWRMHRKIAQSTIRA 6318
6317 FSSANSQTKKVFEQQIVAEATELVEVFLKLGARGQHFNPAHELTVAAANVICALCFGRRY 6138
6137 GHDDQEFRDVLRRIDKFGQTVGAGSLVDVMPWLQSFPNPVRSMFRSFEALNREFFGF 5967
5966 VQLKVEQHRETFDPEVTRDMSDAIISVLEKSDGETALTKDYTEVTMADLIGAGLDTV 5796
5795 STALHWMLLLLVKHPELQSKLHQLIDRVVGRNRLPSIEDRSSLAYLDAFIYETMRFTSFV 5616
5615 PVTIPHSTTSDVTIEGLRIPKDTVVFINQWSVNQDPLMWKDPHVFDPSRFMDEEGSLDRD 5436
5435 LACNVMIFSAGKRRCIGDQIAKVEVFLFFAVLLHQCSFESSADEDLTLNCSYGLTLKPL 5259
5258 DFSITAKLRGKLLKSP* 5208
2A Subfamily
CYP2A1 rat
PIR C41425 (12 amino acids)
Imaoka, S., Kamataki, T. and Funae, Y.
Purification and characterization of six cytochromes P-450
from hepatic microsomes of immature female rats.
J. Biochem. 102, 843-851 (1987)
CYP2A2 rat
PIR S26821 (27 amino acids)
Matsumoto, T., Emi, Y., Kawabata, S. and Omura, T.
Purification and characterization of three male-specific and
one female-specific forms of cytochrome P-450 from rat
liver microsomes.
J. Biochem. 100, 1359-1371 (1986)
Cyp2a4 mouse
GenEMBL J04631 (multiple genomic fragments)
PIR A30499 (494 amino acids) PIR A33531 (494 amino acids)
Lindberg,R., Burkhart,B., Ichikawa,T. and Negishi,M.
The structure and characterization of type I P-450-15-alpha gene as
major steroid 15-alpha-hydroxylase and its comparison with type II
P-450-15-alpha gene
J. Biol. Chem. 264, 6465-6471 (1989)
Cyp2a4 mouse
PIR S16067 (494 amino acids)
Squires, E.J. and Negishi, M.
Reciprocal regulation of sex-dependent expression of
testosterone 15-alpha-hydroxylase (P-450-15-alpha) in liver
and kidney of male mice by androgen. Evidence for a single gene.
J. Biol. Chem. 263, 4166-4171 (1987)
Note: 2a-4 and 2a-5 differ at 11 positions. This sequence is 2a-4 like at
9/11 positions.
Cyp2a5 mouse
GenEMBL J04631 (multiple genomic fragments)
PIR B30499 (494 amino acids) PIR B33531 (494 amino acids)
Lindberg,R., Burkhart,B., Ichikawa,T. and Negishi,M.
The structure and characterization of type I P-450-15-alpha gene as
major steroid 15-alpha-hydroxylase and its comparison with type II
P-450-15-alpha gene
J. Biol. Chem. 264, 6465-6471 (1989)
Cyp2a5 mouse
PIR S16068 (494 amino acids)
Squires, E.J. and Negishi, M.
Reciprocal regulation of sex-dependent expression of
testosterone 15-alpha-hydroxylase (P-450-15-alpha) in liver
and kidney of male mice by androgen. Evidence for a single gene.
J. Biol. Chem. 263, 4166-4171 (1987)
Note: 2a-4 and 2a-5 differ at 11 positions. This sequence is 2a-4 like at
5/11 positions, and 2a-5 like at 6/11 positions
Cyp2a4 or 5 mouse
PIR S03979 (21 amino acids)
Lang, M.A., Juvonen, R., Jaervinen, P., Honkakoski, P. and
Raunio, H.
Mouse liver P450Coh: genetic regulation of the
pyrazole-inducible enzyme and comparison with other P450
isoenzymes.
Arch. Biochem. Biophys. 271, 139-148 (1989)
CYP2A6 human
PIR S17220 (20 amino acids)
Maurice, M., Emiliani, S., Dalet-Beluche, I., Derancourt, J.
and Lange, R.
Isolation and characterization of a cytochrome P450 of the
IIA subfamily from human liver microsomes.
Eur. J. Biochem. 200, 511-517 (1991)
CYP2A6 human
PIR A61272 (13 amino acids)
Yun, C.H., Shimada, T. and Guengerich, F.P.
Purification and characterization of human liver microsomal
cytochrome P-450 2A6.
Mol. Pharmacol. 40, 679-685 (1991)
CYP2A6v2 human
GenEMBL U22027(7215bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
CYP2A7 human
GenEMBL U22029(2282bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
CYP2A7PTX human (retired name see CYP2A18PN)
GenEMBL U22030(1192bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
There are two human pseudogenes of 2A7 on chromosome 19. They are
Located adjacent to each other. This one is telomeric.
CYP2A7PCX human (retired name see CYP2A18PN)
GenEMBL U22044(1192bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
There are two human pseudogenes of 2A7 on chromosome 19. They are
Located adjacent to each other. This one is centromeric.
CYP2A8 Mesocricetus auratus (hamster)
GenEMBL M63788 M34446 M34447 (1771bp)
Lai,T.S. and Chiang, J.Y.L.
Cloning and characterization of two major 3-methylcholanthrene inducible hamster
liver cytochrome P-450s.
Arch. Biochem Biophys. 283, 429-439 (1990)
clone MC1 note: M34446 is incorrectly included in this GenBank entry
and in the 2A9 entry. M34446 should only be in the CYP1A2 hamster entry.
CYP2A9 Mesocricetus auratus (hamster)
GenEMBL M63789 M34446 M34448 (918bp)
Lai,T.S. and Chiang, J.Y.L.
Cloning and characterization of two major 3-methylcholanthrene inducible hamster
liver cytochrome P-450s.
Arch. Biochem Biophys. 283, 429-439 (1990)
clone MC1-81 3 prime end
note: M34446 is incorrectly included in this GenBank entry
and in the 2A8 entry. M34446 should only be in the CYP1A2 hamster entry.
CYP2A9 Syrian hamster
GenEMBL D86953
Kurose,K., Tohkin,M., Ushio,F. and Fukuhara,M.
Cloning and characterization of syrian hamster testosterone
7alpha-hydroxylase, CYP2A9
Arch. Biochem. Biophys. 351, 60-65 (1998)
clone name P450SH2A-1
1 amino acid difference with MC1-81 of Lai and Chiang (incomplete seq.)
CYP2A10 rabbit
GenEMBL L10236 (1641bp) Swiss Q05555 (494 amino acids)
Peng.H.-M., Coon,M.J. and Ding,X.
Isolation and heterologous expression of cloned cDNAs
for two rabbit nasal microsomal proteins CYP2A10 and CYP2A11
that are related to nasal microsomal cytochrome P-450 form a.
J. Biol. Chem. 268,17253-17260 (1993)
CYP2A10/11 rabbit
PIR A31944 (23 amino acids)
Ding, X. and Coon, M.J.
Purification and characterization of two unique forms of
cytochrome P-450 from rabbit nasal microsomes.
Biochemistry 27, 8330-8337 (1988)
CYP2A11 rabbit
GenEMBL L10237 (2484bp) Swiss Q05556 (494 amino acids)
Peng.H.-M., Coon,M.J. and Ding,X.
Isolation and heterologous expression of cloned cDNAs
for two rabbit nasal microsomal proteins CYP2A10 and CYP2A11
that are related to nasal microsomal cytochrome P-450 form a.
J. Biol. Chem. 268, 17253-17260 (1993)
Cyp2a12 mouse
GenEMBL L06463 (1665bp) PIR S32491 (492 amino acids)
Iwasaki,M., Juvonen,R., Lindberg,R. and Negishi,M.M.
Site-directed mutagenesis of mouse steroid 7 alpha-
hydroxylase cytochrome P-450 (7 alpha): Role of residue
209 in determining steroid-cytochrome P-450 interaction.
Biochemical J. 291, 569-573 (1993)
Note: called 7 alpha hydroxylase, but this sequence is very
different from CYP7 sequences. It is actually a 2A sequence.
CYP2A13 human
GenEMBL U22028(8778bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
CYP2A14 Cricetulus griseus (Chinese hamster)
GenEMBL D86954
Fukuhara,M., Kurose, K., Aiba, N., Matsunaga, N., Omata, W., Kato, K.,
and Kimura, M.
A Major Phenobarbital-Inducible P450 Isozyme, CYP2A14, in the
Chinese Hamster Liver: Purification, Characterization, and cDNA
Cloning"
Arch. Biochem. Biophys. 359, 241-248 (1998)
clone P450CH2A-2 85% identical to 2A3 and 2a5
CYP2A15 Cricetulus griseus (Chinese hamster)
GenEMBL AB022916
Kouichi Kurose, Emi Isozaki, Masahiro Tohkin, and Morio Fukuhara
Cloning and expression analysis of a new member of the cytochrome
P450, CYP2A15 from the Chinese hamster, encoding testosterone 7alpha-
Hydroxylase.
Archives of Biochemistry and Biophysics (1999) Vol. 371 pp270-276
91% identical to CYP2A9
CYP2A16 Mesocricetus auratus (Syrian hamster)
GenEMBL D86952
Masahiro Tohkin, Kouichi Kurose, Emi Isozaki, and Morio Fukuhara
Molecular cloning, heterologous expression, and characterization of
a novel member of CYP2A in Syrian hamster"
Biochimica et Biophysica Acta (1999) Vol.1446 pp438-442
94% identical to CYP2A3
CYP2A17 Cricetulus griseus (Chinese hamster)
No accession number
Kouichi KUROSE
86% identical to CYP2A14
submitted to nomenclature committee 11/29/99
CYP2A18PC human pseudogene
AC008537
Hoffman S.M.G., Nelson, D.R. and Keeney, D.S.
Organization, strtucture and evolution of the CYP2 gene cluster
On human chromosome 19.
Pharmacogenetics 2001, in press
C-terminal part of P450 only. This is the opposite end of the
pseudogene CYP2A18PN. This gene appears to be split by a 2B6, 2B7P
insertion.
CYP2A18PN human pseudogene
AC008537
Hoffman S.M.G., Nelson, D.R. and Keeney, D.S.
Organization, strtucture and evolution of the CYP2 gene cluster
On human chromosome 19.
Pharmacogenetics 2001, in press
N-terminal part of P450 only. This is the opposite end of the
pseudogene CYP2A18PC. This gene appears to be split by a 2B6, 2B7P
insertion. This name replaces the old designations CYP2A7PT
and CYP2A7PC. There now seems to be only one copy of this pair
in the sequenced human genome.
CYP2A18PN human pseudogene (formerly CYP2A7PT)
GenEMBL U22030(1192bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
There are two human pseudogenes of 2A7 on chromosome 19. They are
Located adjacent to each other. This one is telomeric.
Note added 4/10/2001 This gene appears to be split by a 2B6, 2B7P
insertion. This name replaces the old designations CYP2A7PT
and CYP2A7PC. There now seems to be only one copy of this pair
in the sequenced human genome.
CYP2A18PN human pseudogene (formerly CYP2A7PC)
GenEMBL U22044(1192bp)
Fernandez-Salguero,P., Hoffman,S.M., Cholerton,S., Mohrenweiser,H.,
Raunio,H., Rautio,A., Pelkonen,O., Huang,J.D., Evans,W.E.,
Idle,J.R. and Gonzalez, F.J.
A genetic polymorphism in coumarin 7-hydroxylation: sequence of the
human CYP2A genes and identification of variant CYP2A6 alleles.
Am. J. Hum. Genet. 57, 651-660 (1995)
There are two human pseudogenes of 2A7 on chromosome 19. They are
Located adjacent to each other. This one is centromeric.
Note added 4/10/2001 This gene appears to be split by a 2B6, 2B7P
insertion. This name replaces the old designations CYP2A7PT
and CYP2A7PC. There now seems to be only one copy of this pair
in the sequenced human genome.
CYP2A19 Sus scrofa (pig)
No accession number
Misaki Kojima
Submitted to nomenclature committee Oct. 27, 2000
89% to human CYP2A13
clone name c7
Cyp2a20p mouse
GenEMBL NW_000310 (52646-53186)
53186 MTLS (frameshift) MLLVAVLTCFIAMITMSVLR*KKLLGK
MPPGPTPLPFLGNFLELDTKKFYDSFLRVVLGREM (0) 52988
52810 IREWYGPVFTVHLGTYSAVVPWGYDVVKETLVDQAEQFSGRGEQAFLDWFFKGYG 52646
CYP2A Macaca fasicularis (monkey)
PIR S36874 (13 amino acids)
Ohmori, S., Horie, T., Guengerich, F.P., Kiuchi, M.and Kitada,M.
Purification and characterization of two forms of hepatic microsomal
cytochrome P450 from untreated cynomolgus monkeys.
Arch. Biochem. Biophys. 305, 405-413 (1993)
CYP2A baboon (Papio sp.)
Swiss P80055 (20 amino acids) PIR S21737 (20 amino acids)
Purification of two cytochrome P450 isozymes related to CYP2A
and CYP3A gene families from monkey (baboon, Papio papio)
liver microsomes. Cross reactivity with human forms.
Dalet-Beluche I., Boulenc X., Fabre G., Maurel P., Bonfils C.
Eur. J. Biochem. 204, 641-648 (1992)
CYP2A bovine
PIR A35704 (18 amino acids)
Lazard, D., Tal, N., Rubinstein, M., Khen, M., Lancet, D. and
Zupko, K.
Identification and biochemical analysis of novel olfactory-specific
cytochrome P-450IIA and UDP-glucuronosyl transferase
Biochemistry 29, 7433-7440 (1990)
2B Subfamily
CYP2B1 or 2 rat
PIR A92255 (22 amino acids) B92255 (22 amino acids)
Botelho, L.H., Ryan, D.E. and Levin, W.
Amino acid compositions and partial amino acid sequences of
three highly purified forms of liver microsomal cytochrome
P-450 from rats treated with polychlorinated biphenyls,
phenobarbital, or 3-methylcholanthrene.
J. Biol. Chem. 254, 5635-5640 (1979)
CYP2B1 or 2 rat
PIR A60822 (20 amino acids)
Amelizad, Z., Narbonne, J.F., Wolf, C.R., Robertson, L.W. and
Oesch, F.
Effect of nutritional imbalances on cytochrome P-450 isozymes
in rat liver.
Biochem. Pharmacol. 37, 3245-3249 (1988)
CYP2B2 rat
GenEMBL S51970 (2946bp)
Hoffmann,M., Mager,W.H., Scholte,B.J., Civil,A. and Planta,R.J.
Analysis of the promoter of the cytochrome P-450 2B2 gene in the
rat.
Gene Expr. 2, 353-363 (1992)
promoter region, no coding sequence
CYP2B2 rat
GenEMBL L28169 (1401bp)
Shephard,E.E.A.
unpublished (1993)
promoter region
CYP2B2 rat
GenEMBL I00525 (427bp)
White,P.C., Dupont,B. and New,M.I.
Genetic probe used in the detection of adrenal hyperplasia
Patent: US 4720454-A 3 19-JAN-1988
Includes I-helix region
CYP2B3 rat
GenEMBL U16209 to U16214
Jean,A., Reiss,A., Desrochers,M., Dubois,S., Trottier,E., Trottier,Y.,
Wirtanen,L., Adesnik,M., Waxman,D.J. and Anderson,A.
Rat liver cytochrome P450 2B3: structure of the CYP2B3 gene and
immunological identification of a constitutive P450 2B3-like protein in
rat liver.
DNA Cell Biol. 13, 781-792 (1994)
CYP2B4 rabbit
GenEMBL L10912 (2026bp)
Ryan,R., Grimm,S.W., Kedzie,K.M., Halpert,J.R. and
Philpot,R.M.
Expression and induction of cytochromes P450 2B and P450 4B,
identification of P450 2B-Bx, and functional comparison of four
highly related forms of P450 2B.
unpublished (1993)
CYP2B4 rabbit
GenEMBL S64259 (2028bp) PIR S35666 (491 amino acids)
Ryan,R., Grimm,S.W., Kedzie,K.M., Halpert,J.R. and Philpot,R.M.
Cloning, sequencing, and functional studies of
phenobarbital-inducible forms of cytochrome P450 2B and 4B
expressed in rabbit kidney
Arch. Biochem. Biophys. 304, 454-463 (1993)
CYP2B4 rabbit
Swiss P00177 PIR S31277 (491 amino acids) S31278 (491 amino acids)
PIR S31279 (491 amino acids)
Gasser R., Negishi M., Philpot R.M.
Primary structures of multiple forms of cytochrome P-450 isozyme 2
derived from rabbit pulmonary and hepatic cDNAs.
Mol. Pharmacol. 32, 22-30 (1988)
CYP2B6 human
PIR S04579 (139 amino acids) PIR S04580 (170 amino acids)
Miles, J.S.,Spurr, N.K., Gough, A.C., Jowett,T., McLaren, A.W.,
Brook,J.D. and Wolf, C.R.
A novel human cytochrome P450 gene (P450IIB): chromosomal
localization and evidence for alternative splicing.
Nuc. Acids Res. 16, 5783-5795 (1988)
CYP2B6 human
GenEMBL M29874
Yamano,S., Nhamburo,P.T., Aoyama,T., Meyer,U.A., Inaba,T.,
Kalow,W., Gelboin,H.V., McBride,O.W. and Gonzalez,F.J.
cDNA cloning and sequence and cDNA-directed expression of human
P450 IIB1: identification of a normal and two variant cDNAs derived
from the CYP2B locus on chromosome 19 and differential expression
of the IIB mRNAs in human liver.
Biochemistry 28, 7340-7348 (1989)
clone name hIIB1
CYP2B7P human
GenEMBL M29873
Yamano,S., Nhamburo,P.T., Aoyama,T., Meyer,U.A., Inaba,T.,
Kalow,W., Gelboin,H.V., McBride,O.W. and Gonzalez,F.J.
cDNA cloning and sequence and cDNA-directed expression of human
P450 IIB1: identification of a normal and two variant cDNAs derived
from the CYP2B locus on chromosome 19 and differential expression
of the IIB mRNAs in human liver.
Biochemistry 28, 7340-7348 (1989)
clone name hIIB3
This entry was originally made then discontinued as 2B7PX because an article by
Miles et al. Nuc. Acids res. 18, 189 (1990) showed evidence of alternative splicing
of CYP2B6. I thought that this explained the difference. However, on going back
and looking at the sequences and the EST data and mRNAs, there are clearly two
different genes in the 2B human subfamily. M29873 has an in frame stop codon,
making it a pseudogene.
Cyp2b9 mouse
GenEMBL M60267 to M60273
Lakso,M., Masaki,R., Noshiro,M. and Negishi,M.
Structures and characterization of sex-specific mouse cytochrome
P-450 genes as members within a large family. Duplication boundary
and evolution
Eur. J. Biochem. 195, 477-486 (1991)
Cyp2b10 mouse
GenEMBL M21856, PIR A60559 (15 amino acids)
Bornheim, L.M. and Correia, M.A.
Purification and characterization of a mouse liver cytochrome
P-450 induced by cannabidiol.
Mol. Pharmacol. 36, 377-383 (1989)
Note: the genome of mouse has only one sequence for Cyp2b10 and Cyp2b20. They are derived from the same gene. The Cyp2b10 mRNA M21856 appears to contain errors in the sequence. No exact match for it can be found in the mouse genome.
This mRNA has an extra exon called exon 8b (27 nucleotides in the heme binding peptide region). This appears to be an alternative splice variant of this gene.
The Cyp2b20 sequence matches the genomic sequence and represents the correct 2b10 sequence. The Cyp2b20 name has been discontinued and Cyp2b10 has been retained
since it is the older of the two names.
GenEMBL M21856 (sequence Cyp2b10 was based on)
MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQMDRGGLLKSLIQ
LREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEY
GVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKS
QGAPLDPTFLFQCITANVICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQ
MFELFSGFLKYFPGAHRQISKNLQELLDYIGHSVERHKATLDPSVPRDFIDIYLLRMEK
EKSNQNAEFHHQNLMMSVLSLFFVGTETSSTTLHYGFLLMLKYPHVTEKVQKEIDQVIGS
HRLPTLDDRTKMPYSDAVIHEIQRFSDLIPIGVPHRVTKDTLFRGYLLPKNTEVYPIL
SSALHDPQYFEQPDSFNPDQFLDANGALKKSEAFLPFST
Exon 8b GQIFDQKSV
GKRICLGESIARSELFLFFTSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR
GenEMBL AK028103 from RIKEN (corrected Cyp2b10/Cyp2b20 sequence)
MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLL
QMDRGGLLKSFIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVA
VVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKS
QGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFE
LFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEKEK
SNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGS
HRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPIL
SSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGKRICLGESIARNELFLFF
TSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR
CYP2B12 rat
GenEMBL S48369 X63545 (2528bp) Swiss P33272 (492 amino acids)
PIR S27160 (492 amino acids)
Friedberg,T., Grassow,M.A., Bartlomowicz-Oesch,B., Siegert,P,
Arand,M., Adesnik,M. and Oesch,F.
Sequence of a novel cytochrome CYP2B cDNA coding for a
protein which is expressed in a sebaceous gland, but not in the liver.
Biochem. J. 287, 775-783 (1992)
Cyp2b13 mouse
GenEMBL M60352 to M60358
Lakso,M., Masaki,R., Noshiro,M. and Negishi,M.
Structures and characterization of sex-specific mouse cytochrome
P-450 genes as members within a large family. Duplication boundary
and evolution.
Eur. J. Biochem. 195, 477-486 (1991)
CYP2B14X rat
discontinued number see CYP2B16P
CYP2B14P rat
GenEMBL U33540
Eric Trottier, Stéphane Dubois, Andréa Jean and Alan Anderson
Identification of CYP2B14P and CYP2B16P, two apparent pseudogenes in the rat
cytochrome P450 2B (CYP2B) subfamily.
Biochemical Pharmacology, 52, 963-965 (1996)
MKPNVLLLLAILLSFLLFLVRGHAKVHGHLPPGPRPLPILGNLLQMDRGGLLQSF
CYP2B15 rat
GenEMBL D17343 to D17349
Nakayama,K., Suwa,Y., Mizukami,Y., Sogawa,K. and Fujii-
Kuriyama, Y.
Cloning and sequencing of a novel rat cytochrome P450 2B-encoding
gene.
Gene 136, 333-336 (1993)
most similar to 2B12, 89% identical
MELGVLLLLTFTVGFLLLLASQNRPKTHGHLPPGPRPLPFLGNLLQMNRRGLLRSFMQLQ
EKYGDVFTVHLGPRPVVILCGTDTIREALVDQAEAFSGRGTVAVLHPVVQGYGVIFANGE
RWKILRRFSLVTMRNFGMGKRSVEERIKEEAQCLVEELKKYKALLNPTSIFQSIAANIIC
SIVFGERFDYKDHQFLRLLDLIYQTFSLMGSLSSQVFELFSGFLKYFPGVHKQISKNLQE
ILNYIDHSVEKHRATLDPNTPRDFINTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFTGT
ETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFA
DLIPIGLPHRVTNDTMFLGYLLPKNTEVYPILSSALHDPRYFDHPDTFNPEHFLDVNGTL
KKSEAFLPFSTGKRICLGEGIAQNELFIFFTAILQNFSLASPVAPEDIDLSPINSGISKI
PSPYQIHFLSRCVG
CYP2B16P rat
GenEMBL U33541 to U33546
Eric Trottier, Stéphane Dubois, Andréa Jean and Alan Anderson
Identification of CYP2B14P and CYP2B16P, two apparent pseudogenes in the rat
cytochrome P450 2B (CYP2B) subfamily.
Biochemical Pharmacology, 52, 963-965 (1996)
note: previously called CYP2B14 in 1993 update. This gene has a complete
coding sequence but there is a defect in the splice junction in intron 1.
Exon 1 MEPSVLLLLAVLLSFLLLLVRGHAKIHGRLPPGPCPVPLLGNLLQMDRRGLLKSFIQLR
Exon 2 EKYGDVFTVHLGLRPVVVLCGTQTIREALVDHAEAFSGRGTIAGLEPVFQDYG
Exon 3 IFFSSGEQWKTLRRFSMATMRDFGMRKKSVEERIKEESQCLVEELKKYQG
Exon 4 APLDPTFLFQCITSNIICSIVFGECFDYTDHQFLHLLDLMYQTFSLLSSIFSQ
Exon 5 VFELFPGVLKYFPGAHRQISRNLHEILDFIGQSVEKHRATLDPNAPRDFIYTYLLHMEK
Exon 6 QKSNHYTEFHHWNLLSSVLSLFFAGTETSSTTLRYGFLIMLKYPHI
Exon 7 EKVQKEIDCVIGSHRLPTLDDRSKMPYTEAVIHEIQRFSDLAPIGTPHRVIKDTIFRGYLLPK
Exon 8 QNTEVFPILSSVLHDPQYFEQPDIFNLQHFLDANGALKIIEAFLPFSTGK
Exon 9 TGKRICLGESIARNELFLFFTTILQNFSVSSPVAPKDIDLTPKESGIGRIPQVYQICFLA
CYP2B17 macaque monkey
PIR JT0676 (491 amino acids)
Ohmori, S.; Sakamoto, Y.; Nakasa, H.; Horie, T.; Saito, K.; Kitada, M.
Nucleotide and amino acid sequences of monkey P450 2B gene
subfamily.
unpublished
CYP2B18 guinea pig
no accession number (437 amino acids)
Oguri, K.
submitted to nomenclature committee
Cyp2b19 mouse
GenEMBL AF047529
Diane Keeney, D.S. (1998) The Novel Skin-Specific Cytochrome P450 Cyp2b19
Maps to Proximal Chromosome 7 in the Mouse, near a Cluster of Cyp2 Family
Genes
Genomics 53, 417-419.
Cyp2b20X mouse
GenEMBL X99715(1416bp)
Damon,M., Fautrel,A., Marc,N., Guillouzo,A. and Corcos,L.
Isolation of a new mouse cDNA clone: hybrid form of cytochrome P450
2b10 and NADPH-cytochrome P450 oxidoreductase
Biochem. Biophys. Res. Commun. 226 (3), 900-905 (1996)
This clone has a part of the NADPH cytochrome P450 reductase on the
opposite strand at the end of the P450 sequence.
note: this sequence was accidentally given the name Cyp2b19. That
name is assigned to a mouse keratinocyte P450 cloned by Diane Keeney.
The reductase sequence at the end of this gene seems to be a cloning
error, because it cannot be found in the genomic DNA sequence.
Cyp2b20 has been merged with Cyp2b10. Though the Cyp2b20 sequence
is more like the genomic sequence, the Cyp2b10 name has precedence.
GenEMBL AF128849
Marc,N., Damon,M., Fautrel,A., Guillouzo,A. and Corcos,L.
Isolation of a cyp2b10-like cDNA and of a clone derived from a
cyp2b10-like pseudogene
Biochem. Biophys. Res. Commun. 258 (1), 11-16 (1999)
This sequence is 100% identical to Cyp2b20 and 97% identical to
Cyp2b10
MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLL
QMDRGGLLKSFIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVA
VVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKS
QGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFE
LFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEKEK
SNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGS
HRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPIL
SSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGKRICLGESIARNELFLFF
TSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR
Cyp2b20X mouse
GenEMBL AK028103 100% identical to AF128849
Now renamed Cyp2b10 (the corrected sequence)
MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLL
QMDRGGLLKSFIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVA
VVEPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKS
QGAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFE
LFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEKEK
SNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGS
HRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPIL
SSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGKRICLGESIARNELFLFF
TSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR
Cyp2b20p1
GenEMBL AF129405
Marc,N., Damon,M., Fautrel,A., Guillouzo,A. and Corcos,L.
Isolation of a cyp2b10-like cDNA and of a clone derived from a
cyp2b10-like pseudogene
Biochem. Biophys. Res. Commun. 258 (1), 11-16 (1999)
This sequence is 100% identical to Cyp2b20 from amino acid 64 on
This seq is partial, starting at amino acid 60 with a stop codon
at amino acid 63. Full length cDNAs AK028103 and AF128849 do not
have this stop codon and it is not found in genomic DNA.
This probably represents a sequence derived from the Cyp2b10 gene.
CYP2B21 rat
GenEMBL AF159245
Nicola Brookman Amissah and Peter Swann
CYP2B22 Sus scrofa (pig)
No accession number
Misaki Kojima
Submitted to nomenclature committee Oct. 27, 2000
78% to rabbit CYP2B4
clone name c780
Cyp2b23 mouse
NW_000307 618973-640139
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Next to 2b24p on chr 7
Cyp2b24p mouse
NW_000307 692575-699876
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Next to 2b19 on chr 7
Cyp2b25p mouse
NW_000307 195792-195980
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Next to 2b9 on chr 7
Cyp2b26p mouse
GenEMBL AC087157 22100-26200
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Between 2b9 and 2b13 on chr 7
Cyp2b27p mouse
NW_000303 2122792-2130037
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Between 2b13 and 2b28p on chr 7
Cyp2b28p mouse
NW_000303 2064442-2094900
Haoyi Wang, Kyle Donley, Diane Keeney, Susan Hoffman
Between 2b27p and 2b10 on chr 7
CYP2B29 hamster
No accession number
Pedro Dominguez
Submitted to nomenclature committee Dec. 17, 2002
77% to cyp2b10
CYP2B guinea pig
Swiss P34033 (20 amino acids)
Narimatsu S., Akutsu Y., Matsunaga T., Watanabe K., Yamamoto I.,
Yoshimura H.
Purification of a cytochrome P450 isozyme belonging to a subfamily of
P450IIB from liver microsomes of guinea pigs.
Biochem. Biophys. Res. Commun. 172, 607-613 (1990)
PIR S28205 (31 amino acids)
Yamada, H., Kaneko, H., Takeuchi, K., Oguri, K. and Yoshimura,H.
Tissue-specific expression, induction, and inhibition through
metabolic intermediate-complex formation of guinea pig
cytochrome P450 belonging to the CYP2B subfamily.
Arch. Biochem. Biophys. 299, 248-254 (1992)
Note: These two fragments are identical over the first 20 amino acids.
Cyp2b mouse
PIR A21630 (25 amino acids)
Stupans, I., Ikeda, T., Kessler, D.J. and Nebert, D.W.
Characterization of a cDNA clone for mouse
phenobarbital-inducible cytochrome p-450b.
DNA 3, 129-137 (1984)
This fragment has one amino acid difference with 2b-9, 2b-10 and 2b-13
Cyp2b mouse
GenEMBL M60359 (997bp)
Lakso,M., Masaki,R., Noshiro,M. and Negishi,M.
Structures and characterization of sex-specific mouse cytochrome
P-450 genes as members within a large family. Duplication boundary
and evolution.
Eur. J. Biochem. 195, 477-486 (1991)
N-terminal 57 amino acid fragment very similar to Cyp2b-13.
CYP2b scup (fish Stenotomus chrysops)
N-terminal fragment (20 amino acids)
Klotz et al. Arch. Biochem. Biophys. 249, 326-338 (1986)
2C Subfamily
CYP2C1 rabbit
GenEMBL D26152 (1695bp)
Noshiro,M., Ishida, H. and Okuda, K.
unpublished (1993)
CYP2C5 rabbit
GenEMBL M55664 (2340bp)
Pendurthi,U.R., Lamb,J.G., Nguyen,N., Johnson,E.F. and Tukey,R.H.
Characterization of the CYP2C5 gene in 21L III/J rabbits: Allelic
variations affects the expression of P450IIC5
J. Biol. Chem. 265, 14662-14668 (1990)
CYP2C5 rabbit
PIR S16715 (143 amino acids) PIR S20227 (145 amino acids)
Zhao, J., Leighton, J.K. and Kemper, B.
Characterization of rabbit cytochrome P450IIC4 cDNA and
induction by phenobarbital of related hepatic mRNA levels.
Biochem. Biophys. Res. Commun. 146, 224-231 (1987)
CYP2C6 rat
PIR A41425 (17 amino acids)
Imaoka, S., Kamataki, T. and Funae, Y.
Purification and characterization of six cytochromes P-450
from hepatic microsomes of immature female rats.
J. Biochem. 102, 843-851 (1987)
CYP2C7 rat
GenEMBL X12595 (1179bp)
Stroem,A., Nilsson,A.G. and Zaphiropoulos,P.
5' flanking sequence of the gene for rat cytochrome p-450f
Nucleic Acids Res. 0, 0-0 (1988)
CYP2C7 rat
PIR S24582 (66 amino acids)
Stroem, A.
unpublished
CYP2C7 rat
PIR A60563 (56 amino acids)
Westin, S., Stroem, A., Gustafsson, J.A., and Zaphiropoulos, P.G.
Growth hormone regulation of the cytochrome P-450IIC
subfamily in the rat: inductive, repressive, and
transcriptional effects on P-450f (IIC7) and P-450-PB1
(IIC6) gene expression.
Mol. Pharmacol. 38, 192-197 (1990)
CYP2C7 rat
PIR A27425 (23 amino acids)
Favreau, L.V., Malchoff, D.M., Mole, J.E. and Schenkman, J.B.
Responses to insulin by two forms of rat hepatic microsomal
cytochrome P-450 that undergo major (RLM6) and minor
(RLM5b) elevations in diabetes.
J. Biol. Chem. 262, 14319-14326 (1987)
CYP2C8 human
PIR S15075 (56 amino acids)
Ged, C. and Beaune, P.
Isolation of the human cytochrome P-450 IIC8 gene: multiple
glucocorticoid responsive elements in the 5' region.
Biochim. Biophys. Acta 1088, 433-435 (1991)
CYP2C8 human
GenEMBL Y00498 (1866bp)
Kimura,S., Pastewka,J., Gelboin,H.V. and Gonzalez,J.
cDNA and amino acid sequences of two members of the human P450IIC
gene subfamily
Nucleic Acids Res. 15, 10053-10054 (1987)
CYP2C8 human
PIR S16902 (349 amino acids)
Shephard, E.A., Phillips, I.R., Santisteban, I., Palmer,
C.N.A. and Povey, S.
Cloning, expression and chromosomal localization of a member
of the human cytochrome P450IIC gene sub-family.
Ann. Hum. Genet. 53, 23-31 (1989)
CYP2C8 human
no accession number
D.C. Zeldin, R.N. Dubois, J.R. Falck, and J.H. Capdevila.
Molecular Cloning, Expression, and Characterization of an Endogenous Human
Cytochrome P450 Arachidonic Acid Epoxygenase Isoform.
Arch. Biochem. Biophys. 322: 76-86 (1995)
CYP2C9 human
GenEMBL S46963 (1814bp) PIR A48390 (477 amino acids)
B48390 (475 amino acids)
Ohgiya,S., Komori,M., Ohi,H., Shiramatsu,K., Shinriki,N. and
Kamataki,T.
Six-base deletion occurring in messages of human cytochrome P-450
in the CYP2C subfamily results in reduction of tolbutamide
hydroxylase activity.
Biochem. Int. 27, 1073-1081 (1992)
CYP2C9 human
GenEMBL L16877 to L16883
Goldstein,J.A., Raucy,J.L., Blaisdell,J.A., Faletto,M.B.
and Romkes,M.
Cloning and expression of complementary DNAs for multiple
members of the human cytochrome P450IIC subfamily.
Biochemistry 30, 3247-3255 (1991)
de Morais,S.M., Schweikl,H., Blaisdell,J.A. and Goldstein,J.A.
Gene structure and upstream regulatory regions of human
CYP2C9 and CYP2C18.
Biochem. Biophys. Res. Commun. 194, 194-201 (1993)
CYP2C9 human
PIR B61265 (225 amino acids)
Srivastava, P.K., Yun, C.H., Beaune, P.H., Ged, C. and
Guengerich, F.P.
Separation of human liver microsomal tolbutamide hydroxylase
and (S)-mephenytoin 4'-hydroxylase cytochrome P-450
enzymes.
Mol. Pharmacol. 40, 69-79 (1991)
2C10 has D at position 417 while 2C9 has G. This sequence does not
include position 417. The only other amino acid difference between 2C9
and 2C10 is at position 358 where 2C9 has Y and 2C10 has C. This
sequence has Y at 358.
CYP2C9 human
PIR S26634 (29 amino acids) PIR S23777 (25 amino acids)
Shimada, T., Misono, K.S. and Guengerich, F.P.
Human liver microsomal cytochrome P-450 mephenytoin
4-hydroxylase, a prototype of genetic polymorphism in
oxidative drug metabolism.
J. Biol. Chem. 261, 909-921 (1986)
CYP2C9 human
PIR S39377 (20 amino acids)
Sandhu, P., Baba, T. and Guengerich, F.P.
Expression of modified cytochrome P450 2C10 (2C9) in
Escherichia coli, purification, and reconstitution of
catalytic activity.
Arch. Biochem. Biophys. 306, 443-450 (1993)
CYP2C10X human
PIR A61265 (79 amino acids)
Srivastava, P.K., Yun, C.H., Beaune, P.H., Ged, C. and
Guengerich, F.P.
Separation of human liver microsomal tolbutamide hydroxylase
and (S)-mephenytoin 4'-hydroxylase cytochrome P-450
enzymes.
Mol. Pharmacol. 40, 69-79 (1991)
2C10 has D at position 417 while 2C9 has G. This sequence shows the D at
position 417. The only other amino acid difference between 2C9 and 2C10
is at position 358 where 2C9 has Y and 2C10 has C. This sequence does
not include the 358 region.
The 2C10 gene is in some doubt. Others have searched 100 samples looking for it
and have not found it. This gene may not exist.
CYP2C11 rat
GenEMBL S68251 (139bp)
Habib,S.L., Srikanth,N.S., Scappaticci,F.A., Faletto,M.B.,
Maccubbin,A., Farber,E., Ghoshal,A.K. and Gurtoo,H.L.
Altered expression of cytochrome P450 mRNA during chemical-induced
hepatocarcinogenesis and following partial hepatectomy
Toxicol. Appl. Pharmacol. 124, 139-148 (1994)
CYP2C11 rat
PIR A60782 (500 amino acids)
Stroem, A., Mode, A., Zaphiropoulos, P., Nilsson, A.G.,
Morgan, E., Gustafsson, J.A.
Cloning and pretranslational hormonal regulation of
testosterone 16alpha-hydroxylase (P-450-16alpha) in male
rat liver.
Acta Endocrinol. 118, 314-320 (1988)
CYP2C11 rat
PIR A60783 (500 amino acids)
Zaphiropoulos, P.G., Mode, A., Stroem, A., Husman, B.,
Andersson, G., Gustafsson, J.A.
Sequence and regulation of two growth-hormone-controlled,
sex-specific isozymes of cytochrome P-450 in rat liver,
P-450-15beta and P-450-16alpha.
Acta Med. Scand. Suppl. 723, 161-167 (1988)
CYP2C11 rat
GenEMBL X79081 (2140bp) PIR S44310 (56 amino acids)
Strom,A., Equchi,H., Mode,A., Tollet,P., Stromstedt,P.E. and
Gustafson,J.
Characterization of the proximal promoter and two silencer elements
in the CYP2C gene expressed in rat liver.
DNA Cell Biol. 13, 805-819 (1994)
CYP2C11 rat
PIR S26818 (500 amino acids)
Matsumoto, T., Emi, Y., Kawabata, S. and Omura, T.
J. Biochem. (1986) 100, 1359-1371
Purification and characterization of three male-specific and
one female-specific forms of cytochrome P-450 from rat
liver microsomes.
CYP2C11 rat
GenEMBL U33173(1856bp)
Yoshioka,H., Morohashi,K., Sogawa,K., Miyata,T., Kawajiri,K.,
Hirose,T., Inayama,S., Fujii-Kuriyama,Y. and Omura,T.
Structural analysis and specific expression of microsomal
cytochrome P-450(M-1) mRNA in male rat livers.
J. Biol. Chem. 262 (4), 1706-1711 (1987)
Erratum:[J Biol Chem 1986 Jun 15;262(17):8438]]
Biagini,C. and Celier,C.
cDNA-directed expression of two allelic variants of cytochrome P450
2C11 using COS1 and SF21 insect cells.
Arch. Biochem. Biophys. 326 (2), 298-305 (1996)
CYP2C12 rat
Swiss B60783 (490 amino acids)
Zaphiropoulos, P.G., Mode, A., Stroem, A., Husman, B.,
Andersson, G., Gustafsson, J.A.
Sequence and regulation of two growth-hormone-controlled,
sex-specific isozymes of cytochrome P-450 in rat liver,
P-450-15beta and P-450-16alpha.
Acta Med. Scand. Suppl. 723, 161-167 (1988)
CYP2C12 rat
PIR S26819 (490 amino acids)
Matsumoto, T., Emi, Y., Kawabata, S. and Omura, T.
J. Biochem. (1986) 100, 1359-1371
Purification and characterization of three male-specific and
one female-specific forms of cytochrome P-450 from rat
liver microsomes.
CYP2C12 rat
PIR B41425 (19 amino acids)
Imaoka, S., Kamataki, T. and Funae, Y.
Purification and characterization of six cytochromes P-450
from hepatic microsomes of immature female rats.
J. Biochem. 102, 843-851 (1987)
CYP2C13 rat
GenEMBL X79810 (1944bp)
Legraverend,C., Eguchi,H., Strom,A., Lahuna,O., Mode,A.,
Tollet,P., Westin,S. and Gustafsson,J.A.
Transactivation of the rat CYP2C13 gene promoter involves HNF-1,
HNF-3 and members of the orphan receptor subfamily.
Biochemistry 33, 9889-9897 (1994)
CYP2C13 rat
PIR S26820 (30 amino acids)
Matsumoto, T., Emi, Y., Kawabata, S. and Omura, T.
Purification and characterization of three male-specific and
one female-specific forms of cytochrome P-450 from rat
liver microsomes.
J. Biochem. 100, 1359-1371 (1986)
CYP2C17X
discontinued number See CYP2C18/19
CYP2C18 human
GenEMBL L16869 to L16876 Swiss P33260 (490 amino acids)
Romkes,M., Faletto,M.B., Blaisdell,J.A., Raucy,J.L. and
Goldstein,J.A.
Cloning and expression of complementary DNAs for multiple
members of the human cytochrome P450IIC subfamily.
Biochemistry 30, 3247-3255 (1991)
de Morais,S.M., Schweikl,H., Blaisdell,J.A. and Goldstein,J.A.
Gene structure and upstream regulatory regions of human
CYP2C9 and CYP2C18.
Biochem. Biophys. Res. Commun. 194, 194-201 (1993)
Romkes,M., Faletto,M.B., Blaisdell,J.A., Raucy,J.L. and
Goldstein,J.A.
Correction: Cloning and expression of complementary DNAs
for multiple members of the human cytochrome P450IIC subfamily.
Biochemistry 32, 1390-1390 (1993)
CYP2C18 human
GenEMBL S63419 S63421 S63424 S63426
X56452 (multiple genomic fragments) PIR S45369 (56 amino acids)
Ged,C. and Beaune,P.
Partial sequence and polymerase chain reaction-mediated analysis of
expression of the human CYP2C18 gene
Pharmacogenetics 2, 109-115 (1992)
CYP2C18 human
PIR A61269 (490 amino acids)
Furuya, H., Meyer, U.A., Gelboin, H.V. and Gonzalez, F.J.
Polymerase chain reaction-directed identification, cloning,
and quantification of human CYP2C18 mRNA.
Mol. Pharmacol. 40, 375-382 (1991)
CYP2C18/19 human
GenEMBL M61858 J05326 (1276bp) Swiss P33259 (270 amino acids)
Goldstein,J.A., Raucy,J.L., Blaisdell,J.A., Faletto,M.B. and
Romkes,M.
Cloning and expression of complementary DNAs for multiple members
of the human cytochrome P450IIC subfamily
Biochemistry 30, 3247-3255 (1991)
This sequence named 2C17 was later found to be a splice of 2C18 amd
2C19. Therefore, there is no 2C17 sequence.
CYP2C18/19 human
GenEMBL L07093 (2395bp)
Romkes,M., Faletto,M.B., Blaisdell,J.A., Raucy,J.L. and
Goldstein,J.A.
Correction: Cloning and expression of complementary cDNAs for
multiple members of the human cytochrome P450IIC subfamily
Biochemistry 32, 1390-1390 (1993)
CYP2C19 human
Swiss P33261 (490 amino acids)
Romkes,M., Faletto,M.B., Blaisdell,J.A., Raucy,J.L. and
Goldstein,J.A.
Cloning and expression of complementary DNAs for multiple
members of the human cytochrome P450IIC subfamily.
Biochemistry 30, 3247-3255 (1991)
CYP2C19 human
GenEMBL L31506 (129bp)
GenEMBL L31507 (129bp)
De Morais,S.M.F., Wilkinson,G.R., Blaisdell,J.A., Nakamura,K.,
Meyer,U.A. and Goldstein,J.A.
The major genetic defect responsible for the polymorphism of
S-mephenytoin metabolism in humans
J. Biol. Chem. 269, 15419-14522 (1994)
CYP2C19 human
GenEMBL L32982 (329bp) wild type exon 4
GenEMBL L32983 (329bp) mutant exon 4
De Morais,S.M.F., Wilkinson,G.R., Blaisdell,J.A., Meyer,U.A.,
Nakamura,K. and Goldstein,J.A.
Identification of a new genetic defect responsible for the
polymorphism of S-mephenytoin metabolism in Japanese
Mol. Pharmacol. 46, 594-598 (1994)
CYP2C19 human
PIR S38753 (16 amino acids)
Wrighton, S.A., Stevens, J.C., Becker, G.W., and van den Branden,M.
Isolation and characterization of human liver cytochrome P450
2C19: correlation between 2C19 and S-mephenytoin
4'-hydroxylation.
Arch. Biochem. Biophys. 306, 240-245 (1993)
CYP2C20 Macaca fasicularis (monkey)
GenEMBL S53046 (1901bp) Swiss P33262 (490 amino acids)
PIR S28166 (490 amino acids)
Komori,M., Kikuchi,O., Sakuma,T., Funaki,J., Kitada,M.
and Kamataki,T.
Molecular cloning of monkey liver cytochrome P-450 cDNAs:
similarity of the primary sequences to human cytochromes P-450.
Biochim. Biophys. Acta 1171, 141-146 (1992)
CYP2C20 Macaca fasicularis (monkey)
PIR A60466 (22 amino acids)
Ohi, H., Toratani, S., Komori, M., Miura, T., Kitada, M. and
Kamataki, T.
Comparative study of cytochrome P-450 in liver microsomes. A
form of monkey cytochrome P-450, P-450-MK1,
immunochemically cross-reactive with antibodies to rat
P-450-male.
Biochem. Pharmacol. 38, 361-365 (1989)
CYP2C23 rat
GenEMBL U04733 (1919bp)
Karara,A., Makita,K., Jacobson,H.R., Falck,J.R.,
Guengerich,F.P., DuBois,R.N.and Capdevila,J.H.
Molecular cloning, expression, and enzymatic characterization of the
rat kidney cytochrome P-450 arachidonic acid epoxygenase.
J. Biol. Chem. 268, 13565-13570 (1993)
CYP2C23 rat
GenEMBL S67064 (265bp)
Imaoka,S., Wedlund,P.J., Ogawa,H., Kimura,S., Gonzalez,F.J.
and Kim,H.Y.
Identification of CYP2C23 expressed in rat kidney as an arachadonic
acid epoxygenase.
J. Pharmacol. Exp. Ther. 267, 1012-1016 (1993)
CYP2C23 rat
PIR S29817 (20 amino acids)
Marie, S.; Roussel, F.; Cresteil, T.
Age- and tissue-dependent expression of CYP2C23 in the rat.
Biochim. Biophys. Acta 1172, 124-130 (1993)
note: This sequence is diiferent from GenEMBL U04733 and S67064
by one amino acid. PIR S13101, SwissProt P24470 and GenEMBL
X55446 are all equivalent, but they have a frame shift in the sequence
in the region of this 20 amino acid fragment. Amino acids 38-54 are affected.
CYP2C24 rat
GenEMBL S59647 (226bp)
GenEMBL S59648 (187bp)
GenEMBL S59652 (380bp)
Zaphiropoulos,P.G.
Differential expression of cytochrome P450 2C24 and transcripts
in rat kidney and prostate: evidence indicative of alternative
and possibly trans splicing events.
Biochem. Biophys. Res. Commun. 192, 778-786 (1993)
CYP2C24 rat
Swiss P33273 (434 amino acids) PIR PT0435 (302 amino acids)
PIR JH0451 (434 amino acids)
Zaphiropoulos,P.G.
cDNA cloning and regulation of a novel rat cytochrome P450 of the 2C
gene sufamily (P450IIC24).
Biochem. Biophys. Res. Commun. 180, 645-651 (1991)
CYP2C25 Mesocricetus auratus (Syrian hamster)
GenEMBL X63022 (1829bp, incorrectly given as X60322 in Table 3
of the 1993 nomenclature update)
Sakuma,T., Masaki,K., Itoh,S., Yokoi,T. and Kamataki,T.
Sex-related difference in the expression of cytochrome P450 in
hamsters: cDNA cloning and examination of the expression of three
distinct CYP2C cDNAs.
Molec. Pharmacol. 45, 228-236 (1994)
CYP2C26 Mesocricetus auratus (Syrian hamster)
GenEMBL D11435 (1808bp) Swiss P33263 (490 amino acids)
Sakuma,T., Masaki,K., Itoh,S., Yokoi,T. and Kamataki,T.
Sex-related difference in the expression of cytochrome P450 in
hamsters: cDNA cloning and examination of the expression of three
distinct CYP2C cDNAs.
Molec. Pharmacol. 45, 228-236 (1994)
CYP2C27 Mesocricetus auratus (Syrian hamster)
GenEMBL D11436 (1784bp) Swiss P33264 (490 amino acids)
Sakuma,T., Masaki,K., Itoh,S., Yokoi,T. and Kamataki,T.
Sex-related difference in the expression of cytochrome P450 in
hamsters: cDNA cloning and examination of the expression of three
distinct CYP2C cDNAs.
Molec. Pharmacol. 45, 228-236 (1994)
CYP2C28 Mesocricetus auratus (Syrian hamster)
GenEMBL D11437 (1556bp) Swiss P33265 (490 amino acids)
Sakuma,T., Masaki,K., Itoh,S., Yokoi,T. and Kamataki,T.
Sex-related difference in the expression of cytochrome P450 in
hamsters: cDNA cloning and examination of the expression of three
distinct CYP2C cDNAs.
Molec. Pharmacol. 45, 228-236 (1994)
Cyp2c29 mouse
GenEMBL D17674 (1751bp)
Matsunaga,T., Watanabe,K., Yamamoto,I., Negishi, M.,
Gonzalez,F.J. and Yoshimura, H.
cDNA cloning and sequence of CYP2C29 encoding P-450 MUT-2,
a microsomal aldehyde oxygenase.
Biochim. Biophys. Acta 1184, 299-301 (1994)
Cyp2c29 mouse
PIR A61268 (16 amino acids)
Bornheim, L.M. and Correia, M.A.
Purification and characterization of a mouse liver cytochrome
P-450 induced by cannabidiol.
Mol. Pharmacol. 36, 377-383 (1989)
Cyp2c29v2 mouse
no accession number
Gang Luo and Joyce A. Goldstein
clone M2c9k
submitted to Nomenclature Committee
CYP2C30 rabbit
GenEMBL D26153
Noshiro,M., Ishida,H. and Okuda,K.
unpublished (1993)
CYP2C31 Capra hircus (dwarf goat)
GenEMBL X76502 (1185bp) PIR JC2199 (284 amino acids)
PIR S39314 (284 amino acids)
Zeilmaker,W.M., Van't Klooster,G.A.E., Gremmels-Gerhmann,F.J.
Van Miert,A.S.J. and Horbach,G.J.M.J.
cDNA and deduced amino acid sequence of a dwarf goat liver
cytochrome P450-fragment belonging to the CYP2C gene subfamily.
Biochem. Biophys. Res. Commun. 200, 120-125 (1994)
CYP2C32 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
most similar to 2C24
Clone name CL1
CYP2C33v1 pig
GenEMBL U35837 (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name CL7
CYP2C33v2 pig
GenEMBL U35838 (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name CL8
CYP2C33v3 pig
GenEMBL U35839 (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name PF1
CYP2C33v4 Sus scrofa (pig)
No accession number
Misaki Kojima
Submitted to nomenclature committee Oct. 27, 2000
2 amino acids diffs with 2C33v1 and v2
clone name c296
CYP2C34v1 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name PF15
CYP2C34v2 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name CL6
CYP2C34v3 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name Cl12
CYP2C34v4 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name Cl13
CYP2C35 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name PF11/14
CYP2C36 pig
no accession number (681bp)
Zaphiropoulos,P.G., Skantz,A., Eliasson,M. and Ahlberg,M.B
Cytochrome P450 genes expressed in porcine ovaries: identification of novel
forms, evidence for gene conversion, and evolutionary relationships.
Biochem. Biophys. Res. Commun. 212, 433-441 (1995)
Clone name PF13
CYP2C37 macaque [name conflict, reassigned to CYP2C43]
no accession number
S. Ohmori
submitted to Nomenclature Committee
Cyp2c37 mouse
AF047542 NM_010001
Luo G, Zeldin DC, Blaisdell JA, Hodgson E, Goldstein JA.
Cloning and expression of murine CYP2Cs and their ability to
metabolize arachidonic acid.
Arch Biochem Biophys. 357, 45-57 1998.
clone M2c10b
submitted to Nomenclature Committee
Cyp2c38 mouse
AF047725
Luo G, Zeldin DC, Blaisdell JA, Hodgson E, Goldstein JA.
Cloning and expression of murine CYP2Cs and their ability to
metabolize arachidonic acid.
Arch Biochem Biophys. 357, 45-57 1998.
clone M2c13f
submitted to Nomenclature Committee
Cyp2c39 mouse
AF047726 NM_010003
Luo G, Zeldin DC, Blaisdell JA, Hodgson E, Goldstein JA.
Cloning and expression of murine CYP2Cs and their ability to
metabolize arachidonic acid.
Arch Biochem Biophys. 357, 45-57 1998.
clone M2c9d
submitted to Nomenclature Committee
Cyp2c40 mouse
AF047727 NM_010004 NW_000147 exons 2-6 only
Luo G, Zeldin DC, Blaisdell JA, Hodgson E, Goldstein JA.
Cloning and expression of murine CYP2Cs and their ability to
metabolize arachidonic acid.
Arch Biochem Biophys. 357, 45-57 1998.
Tsao CC, Foley J, Coulter SJ, Maronpot R, Zeldin DC, Goldstein JA.
CYP2C40, a unique arachidonic acid 16-hydroxylase, is the major CYP2C
in murine intestinal tract.
Mol Pharmacol. 58, 279-87 2000
clone M2c9h
submitted to Nomenclature Committee
CYP2C41 dog
no accession number
Stephen R. Bai and Joyce A. Goldstein
clone M2c9h
submitted to Nomenclature Committee
CYP2C42 pig
GenEMBL Z93098 (1307bp)
Nissen,P.H., Winteroe,A.K. and Fredholm,M.
Characterization and mapping of three porcine genes belonging to
the cytochrome P450 superfamily
Unpublished
clone 10b03
CYP2C42P1 pig
GenEMBL Z93100 (1758bp)
Nissen,P.H., Winteroe,A.K. and Fredholm,M.
Characterization and mapping of three porcine genes belonging to
the cytochrome P450 superfamily
Unpublished
clone 15d09 (pseudogene)
CYP2C43 macaque
no accession number
S. Ohmori
submitted to Nomenclature Committee
[name conflict, formerly CYP2C37 reassigned to CYP2C43]
Cyp2c44 mouse
no accession number
Christian Helvig and Jorge H. Capdevila
submitted to nomenclature committee Oct. 2, 1998
most similar to CYP2C23 (87% identical)
CYP2C45 gallus gallus (chicken)
No accession number
Manuel Baader
Submitted to nomenclature committee Nov. 22, 1999
57% identical to CYP2C9
CYP2C46 rat
No accession number
Lars von Buchholtz
Submitted to nomenclature committee March 6, 2000
91% to 2C24
CYP2C47 Phascolarctos cinereus (koala)
No accession number
Ross McKinnon
Submitted to nomenclature committee May 25, 2000
60% identical to many 2C sequences
CYP2C48 Phascolarctos cinereus (koala)
No accession number
Brett Jones and Ross McKinnon
Submitted to nomenclature committee Nov. 6, 2000
92% identical to 2C47
CYP2C49 Sus scrofa (pig)
No accession number
Misaki Kojima
Submitted to nomenclature committee Oct. 27, 2000
92% to 2C35 and 2C34v1, v3, v4
clone name c195
Cyp2c50 mouse
No accession number GSS AZ589908 one exon only
ESTs AI118193 ue34e02.x1, opposite end = AI098787 ue34e02.y1
AI097740 AI117011 AI119501 AI314482 BF385641 AI528254
AA968308 AI876138 AI097678 AI226027 BF384486 BF659471 AI529923
AI266900 uj08d09.x1, opposite end AI226027 uj08d09.y1,
Joyce Golstein and Cheng-Chung Tsao
submitted to nomenclature committee 3/1/2001
94% to 2c37; 75% 2c39,2c29v2; 74% 2c38; 68% 2c40; 53% 2c44
name 2C heart
Cyp2c51X? mouse
No accession number
Joyce Golstein and Cheng-Chung Tsao
submitted to nomenclature committee 3/1/2001
69% to 2c29v2; 69% 2c37; 68% 2c38; 67% 2c39; 67% 2c40
no exact hits in nr, htgs, est, gss or sts on 3/5/01
name 2C aorta
note: this seq appears to be a combination between 2c52p and 2c69
it may not be a real gene
Cyp2c52p mouse
No accession number
Joyce Golstein and Cheng-Chung Tsao
submitted to nomenclature committee 3/1/2001
78% to 2c51, 70% to 2c29v2, 2c38; 67% to 2c39, 2c37; 61% to 2c40
missing PYTD in K-helix
no exact hits in nr, htgs, est, gss or sts on 3/5/01
name 2C kidney, 2C eye
Cyp2c53p mouse
AC078913.5 seq b assembled from parts 74% to 2c39
Old assembly included some N- and C-term parts not from this gene
TNFSKVYGPVFTLYLGMKPTVVLHGYEAVKEALIDHGEEFAVKGIFPLAEKNSK
FTLMTLKNLGMGKRNIEDRVQEEAQCLVEELRKTNG
SLCDPTFILGCAPCNVTCSIIFQNHFDYKDQDFLSLMEKINENTKIVSTPWIQ
LIVYCPGSHKTVPENAYYIEIYILKKIKEHQESLDVTNPLDFIDYYLIKCKQ
GAGTETSTTLRYALLLLMTYPEVT
Cyp2c53p mouse
AY227735 NW_000145
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c66 and Cyp2c29 on chr 19
Temp name 2CN6
74% to 2c29
note: this may be a pseudogene. There are two stop codons
near the C-helix and the WXXXR motif is missing
this is being checked now in the cloned cDNA.
Cyp2c54 mouse
No accession number
Darryl Zeldin
submitted to nomenclature committee 3/18/2002
clone name N1
92% to 2c50 91% to 2c37 76% to 2c29 73% to 2c38 74% to 2c39
70% to 2c40 67% to 2c55 66% to 2c53p 59% to 2c44 67% to 2c52p
68% to 2c51
Cyp2c55 mouse
No accession number
Darryl Zeldin
submitted to nomenclature committee 3/18/2002
clone name N3
71% to 2c29 70% to 2c39 70% top 2c38 69% to 2c37 69% to 2c50
65% to 2c40 58% to 2c44 53% to 2c53p 59% to 2c52p 67% to 2c54
67% to 2c51
CYP2C56P human
NT_022154.9|Hs2_22310
2C pseudogene fragment chr 2
1768949 LSSKVQEETDHAVGRHWRPCMQDRSHMPYTEAMVHEVQRH*PHPTNVPHALTSDIKFRN 1769125
1769126 YLLPK
CYP2C57P human
AC022650 41% to 2C9 pseudogene 2 in frame stops
GIAFSHGETWKTMRRFSLTTLRNFGMGEWIIEDTIIEECQNLIQ
NMFLVLGFLLKSHKTILRNRDELFSFIRMAFLDHHHKLDKNDPRNFTDVFLVTQQE
ENDTFADYFSDKKLVTLVNNLFTTGTETTASTLHWGILLVMRYPEVQS
KVHNEITKVVVSAQS*LAHRTQMTHTDAVI*EVQRFANILPTSLSHATTTNIFKNYCIPK
GTEVIILLASVARDQAQWEKPDTFNPEHFLNSKEKFIKREAFLPF
CYP2C58P human
NT_008769.11|Hs10_8926
lone exons 1,2,3 between 2C19 and 2C9
same as AL133513.12
8303126 LDLAAVLMLCLSCLLLLSL*TQISGRGKLPSDSTPLQVIESILQMADKDICKSSSNLSTLY 8302944
8296311 SLYFDMKLVLVLHGYEVLKKALIHHGEEFSGKGIFPVSKK 8296192
8295999 IIFSNRKPCKEIWPFLLMTLWNCGVVKRS 8295913
8295911 LGKHVQVEAHCIVWELRRTK 8295852
CYP2C59P human
NT_008769.11|Hs10_8926
lone exons 2,3 between 2C9 and 2C8
8437561 LSQFSKVYVPVFTVYFDIKLVLELHGYEVVKEALIDHGEEFSGKGIFPVSKKS**G 8437394
8437211 FRIIFSNGKRCKDIWLFLLMTLWNCRMVKRS 8437119
8437115 MEKHVQGEAQCLRQELRRTK 8437058
CYP2C60P human
NT_008769.11|Hs10_8926
lone exon 6 between 2C9 and 2C8
8439669 EKDNQPLKFTIENLVGNVPDLFVAGTEMTSTTLRYGLLLLLKHPELTGR 8439815
CYP2C61P human
NT_008583.11|Hs10_8740
chromosome 10 pseudogene frag parts of exons 1 and 2
1832658 KGKLPHDLTSFLFVGNILQLNSKNLSKSITMLAKDYGPGFTVYFGIKPTVVV 1832813
CYP2C62P human
AL138921 NT_030059 chromosome 10 50% to 2C8
LAMCVTCLIFFLVWKKSPSPTPLPTIGNRLQRNPKD
CISFQLAKEYSSVYTLYFGSWPTMVFHGYKAVKEALIDQGDKSLGRGHIPIIDDAQKRY
TSAQPFDSTFILASAPCNL
CSFLFKECFQYKNETFLSLMGLLNENVK
TTVLPLLSLVLFSYKQFP
GHFLDKNGCFNKTDYFLPFSLGK
CYP2C63P human
NT_011512.5|Hs21_11669
chromosome 21 51% to 2C9
12398358 CPSCLILLFLWNGSYAKGKLLPGPIPLPIV*NILPLRSMNTSKSISMVS 12398212
CYP2C64P human
NT_011602.7|HsX_11759
2C pseudogene fragment chr X 57% to 2C8
435396 ASVDLAAVLVLFLSHFLFLSLWKQSSEREKLLPGPTPIRIIGNILELDLKDICKSLSDVN 435575
435576 MLYAPL 435593
Cyp2c65 mouse
AY227733 NW_000145
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c55 and Cyp2c66 on chr 19
Temp name 2CN4
93% to Cyp2c66 73% to 2c29
Cyp2c66 mouse
AY227734 NW_000145
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c65 and Cyp2c53p on chr 19
Temp name 2CN5
93% to Cyp2c65 73% to 2c29
Cyp2c67 mouse
GenEMBL NW_030157.1 (aa 1-274 exons 1-5 minus strand)
GenEMBL NW_022459.1 (aa 275-320 exon 6 plus strand)
GenEMBL NW_021833.1 (aa 321-431 exons 7-8 plus strand)
Part of exon 9 not found
GenEMBL NW_020256.1 (aa 469-491 end of exon 9 plus strand)
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c39 and Cyp2c68 on chr 19
Temp name 2CN7
95% to Cyp2c40
Cyp2c68 mouse
GenEMBL NW_034810.1 (aa 1-161 exons 1-3 plus strand)
Exon 4 not found
GenEMBL NW_012728.1 (aa 215-273 exon 5 minus strand)
Exon 6 not found
GenEMBL NW_024952.1 (aa 321-383 exon 7, 2 copies on this contig)
GenEMBL NW_012306.1 (aa 356-431 part of exon 7 and exon 8)
Exon 9 not found
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c67 and Cyp2c40 on chr 19
Temp name 2CN8
96% to Cyp2c40
Cyp2c69 mouse
GenEMBL NW_024021.1 (aa 1-56 exon 1 plus strand)
GenEMBL NW_009479.1 (aa 57-160 exon 2-3 minus strand)
GenEMBL NW_014461.1 (aa 161-214 exon 4 plus strand)
Exon 5 not found
GenEMBL NW_024085.1 (aa 276-320 exon 6 plus strand)
GenEMBL NW_021729.1 (aa 321-491 exons 7-9 plus strand)
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between Cyp2c40 and Cyp2c37 on chr 19
Temp name 2CN9
95% to Cyp2c40
Cyp2c70 mouse
AY227736 NW_000148 NP_663474 LOC226105
Hong Wang, Joyce Goldstein, Darryl Zeldin
50kb downstream of Cyp2c50 on chr 19
Temp name 2CN10
59% to Cyp2c29
Cyp2c71p mouse
NW_000148
Between 2c69 and 2c37 on chr 19
69% to Cyp2c69
8628 MGPFVVLVLRLSFLLLLSL*RQRSGRGKLPPGLTPCSINGNFLQIDMKDTHQSLTNVSMP 8449
8448 YAPQVY 8431 exon 1 (in opposite orientation to other exons)
14397 CP*SYNIFF*-IIHVLSYLLEKIKENEELMDVTNP*DFIDYFLIQRHQVKG 14546 exon 5
32761 GTTVLTPLSSVLHDSKEFPNPEMFDPDHFLDGNGNFK*SDYFMPFSAGNR 32910 exon 8
39003 GKFS*TEHSL-FPIRKWMCMGESLALMELILFLTTILQNF*LKSLVDLKDNNITPVYSGL 39179
39180 F*VPPTFLVCFI 39215 exon 9
Cyp2c72p mouse
NW_000145
Hong Wang, Joyce Goldstein, Darryl Zeldin
Between 2c29and 2c38
Temp name 2CN11
88% to 2c38, 87% to 2c39
1 MDLITFLVLT LSSLILLLLW RQRSGRGRLP PGPTPFPIIG NFLQIDGKNF
51 SQSLTNFSKA YGPMFTLYLG SQPIAVLHGY EAVKEALIDH GEEFSGRRNI
101 PMAEKINNSL GVIFSNGNRW KEIRHFTLTI LRNLGMGKRN IEDRVQEEAQ
151 CLVEELRKTN
CYP2C rat
no accession number (639bp)
Zaphiropoulos,P.
submitted to nomenclature committee
82% amino acid identity to exon 2 of 2C24
CYP2C rat
no accession number (397bp)
Zaphiropoulos,P.
submitted to nomenclature committee
similar to exon 3 of 2C7
possible pseudogene, with stop codon at location of conserved trp.
CYP2C rat
PIR B60822 (19 amino acids)
Amelizad, Z., Narbonne, J.F., Wolf, C.R., Robertson, L.W. and
Oesch, F.
Effect of nutritional imbalances on cytochrome P-450 isozymes
in rat liver.
Biochem. Pharmacol. 37, 3245-3249 (1988)
CYP2C dog
PIR A60465 (33 amino acids)
Komori, M., Shimada, H., Miura, T. and Kamataki, T.
Interspecies homology of liver microsomal cytochrome P-450. A
form of dog cytochrome P-450 (P-450-D1) crossreactive with
antibodies to rat P-450-male.
Biochem. Pharmacol. 38, 235-240 (1989)
Note: probable N-terminal of 2C21 which is missing the N-terminal region
CYP2C horse
PIR PN0659 (16 amino acids)
Komori, M., Higami, A., Imai, Y., Imaoka, S. and Funae, Y.
Purification and characterization of a form of P450 from
horse liver microsomes.
J. Biochem. 114, 445-448 (1993)
2D Subfamily
CYP2D1 rat
PIR A30495 (19 amino acids)
Gonzalez, F.J., Matsunaga, T., Nagata, K., Meyer, U.A.,
Nebert, D.W., Pastewka, J., Kozak, C.A., Gillette, J.,
Gelboin, H.V. and Hardwick, J.P.
Debrisoquine 4-hydroxylase: characterization of a new P450
gene subfamily, regulation, chromosomal mapping, and
molecular analysis of the DA rat polymorphism.
DNA 6, 149-161 (1987)
CYP2D1 rat
PIR S39761 (13 amino acids)
Ohishi, N., Imaoka, S., Suzuki, T. and Funae, Y.
Characterization of two P-450 isozymes placed in the rat
CYP2D subfamily.
Biochim. Biophys. Acta 1158, 227-236 (1993)
CYP2D6 human
GenEMBL M24499 (1195bp)
Manns,M.P., Johnson,E.F., Griffin,K.J., Tan,E.M. and Sullivan,K.F.
Major antigen of liver kidney microsomal autoantibodies in
idiopathic autoimmune hepatitis is cytochrome P450db1
J. Clin. Invest. 83, 1066-1072 (1989)
CYP2D6 human
GenEMBL A20907 (1768bp)
Genetic assay for cytochrome p450
Patent: WO 9110745-A 13 25-JUL-1991;
CYP2D6 human
GenEMBL M33189 (5503bp)
Gonzalez,F.J.
unpublished (1990)
CYP2D7AP human
GenEMBL X58467 (13,278bp)
Heim,M.H. and Meyer,U.A.
Evolution of a highly polymorphic human gene locus for
a drug metabolizing enzyme.
Genomics 14,49-58 (1992)
Note: CYP2D7AP is 94.7% identical to CYP2D7P, both are
pseudogenes.
CYP2D8BP human
GenEMBL X58468 (13,677bp)
Heim,M.H. and Meyer,U.A.
Evolution of a highly polymorphic human gene locus for
a drug metabolizing enzyme.
Genomics 14,49-58 (1992)
Note: CYP2D8P is a chimeric gene composed of part of
CYP2D7AP and part of CYP2D6. There are only 14 base
changes in 13,677 base pairs relative to these parents.
This gene is different from CYP2D8P. It is a pseudogene.
Cyp2d9 mouse
GenEMBL J04471 M24262 (846bp) M24267 (3367bp)
Wong,G., Itakura,T., Kawajiri,K., Skow,L. and Negishi,M.
Gene family of male-specific testosterone 16-alpha-hydroxylase
(C-P-450-16-alpha) in mice: Organization, differential regulation,
and chromosome location
J. Biol. Chem. 264, 2920-2927 (1989)
Cyp2d10 mouse
GenEMBL J04471 M24263 M24265 M24268 (4828bp)
Wong,G., Itakura,T., Kawajiri,K., Skow,L. and Negishi,M.
Gene family of male-specific testosterone 16-alpha-hydroxylase
(C-P-450-16-alpha) in mice: Organization, differential regulation,
and chromosome location
J. Biol. Chem. 264, 2920-2927 (1989)
Cyp2d11 mouse
GenEMBL J04471 M24264 M24266 (5661bp)
Wong,G., Itakura,T., Kawajiri,K., Skow,L. and Negishi,M.
Gene family of male-specific testosterone 16-alpha-hydroxylase
(C-P-450-16-alpha) in mice: Organization, differential regulation,
and chromosome location
J. Biol. Chem. 264, 2920-2927 (1989)
Cyp2d12 mouse
no accession number
Negishi,M.
submitted to nomenclature committee in 1990, but never published.
ESTs AI116003 ue25f10.x1 (295-end 2 diffs, 1fs) AI785325 uj40c11.x1
(326-end 1 diff) AI527869 uj30b05.y1 (1-241 4 diffs, 2fs) AA986388
uc82e10.x1 (307-end 4 diffs)
Public Cyp2d12 from EST sequences. Places where ESTs do not match Negishi's
sequence are shown in (). The EST seq is given. In these sites Y, G, N, A and R
are observed in multiple ESTs and they are probably the correct amino acids
F at the last variable site is seen twice and S is seen twice so this may be a
polymorphic site
MELLTGTDLWSVAIFTVIFILLVDLM (Y) RRQSWTSCYPPGPVPWPVL (G) NLLQVDL (N) NMPYSL
YKLQNRYGDVFSLQMAWKPMVVINRMKAMKEVLLTCGEDTADRPPVPIFEHLGFKPRSQGMIFAPYGPEWREQ
RRFSLSSLRNFGLGRKSLEEWVIKEAGHLCDAFTTQAGQYINPNTMLKK (A) TCNVIASLIFARRFEYED
PYLIRMLKVLEDSLTELSGLIPEVINTFPILLHIPRLAD
(53 amino acid gap)
ENLRMVVIDLFTAGILTTSTTLSWALLLMILHPDVQRRVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPLHLPRITSRDIEVQDFLIPKGTILLPNMSSVHMDDTVWEKPLRFHPEHFLDAQGHFVKHEAFITFSAG (R) RSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPQPSDHRVF (F) IMVAPSPYQLCAVIREQGH*
Cyp2d13 mouse
no accession number
Negishi,M.
submitted to nomenclature committee in 1990, but never published.
no exact matches in the Genbank EST database as of 10/20/97
sequence may be erroneous, or a rare transcript.
Cyp2d13 mouse
No accession number
Brian Libby
partial Cyp2d13 gene sequence
The top half of the sequence below is from Brian Libby
This sequence matches Negishi's except at one amino acid
shown in parentheses. The bottom half is from EST BF533324
Dr. Negishi's sequence called "ce" is complete, but still
unpublished. (see note to Cyp2d26)
Public Cyp2d13 seq from BF533324 EST and Brian Libby. One extra amino acid
seen in EST BF533324 is shown as [D]. Two amino acids that do not agree
are shown in (). The EST sequence is given at the T and G sites.
MELLTGTGLWPVAIFTVIFILLVDLMHRRQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYSLYKL
QNRYGDVFSLQMAWKPVVVISGLKAVREVLVTCGEDTADRPEMPIFQHLGYGEKAKGVVF
APYGPEWRELRRFSVSTLRNLGLGKKSLEQWVTEEAGHLCDAFTAQAGSPLDPYTLLNKAVCNV
IASLIYARRFEYGDPDFIKMLKILKENMGENTGLFPE
(15 amino acid gap)
DKVFPGQKTFLTLVNKLVTEHKRTWDP [D] QPPRDLTDAFLAEMEKAKGNPKSSFNEANLRL
VVFDLFGAGIVTSSITLTWALLLMILHPDVQRRVQEEIDEVIGQVRCPEMADQAHMPYTNAVIH
EVQRFADIVPMNLPHKTSHDIEVQGFLIPKGTTLIPNLSS (T) LKDETVWEKPLRFHPEHFL
DAQGHFVKPEAFMPFSAGRRACLGEPL (G) RMELFLFFTCLLQRFSFLVPAGQPQPSDYGIF
TFLVSPSPYQLCAFTRDQATN*
CYP2D14 bovine
GenEMBL S45538 X68013 (1538bp) Swiss Q01361 (487 amino acids)
PIR S29295 S37284 (500 amino acids) PIR S29862 (500 amino acids)
Tsuneoka,Y., Matsuo,Y., Higuchi,R. and Ichikawa,Y.
Characterization of the cytochrome P-450IID subfamily in
bovine liver. Nuceotide sequences and microheterogeneity.
Eur. J. Biochem. 208, 739-746 (1992).
CYP2D15 dog
GenEMBL D17397 (1665bp)
Sakamoto,K., Kirita,S., (Aoyama,J., Baba,T. and Matsubara,T.)
cDNA cloning and characterization of dog P-450 2D.
Arch. Biochem. Biophys. 319, 372-382 (1995)
check authors on paper
CYP2D15 dog
no accession number (1640bp)
Tasaki,T., Ito,S., Kamataki,T. and Fujita,S.
unpublished
CYP2D16 guinea pig
GenEMBL U21486 (1666bp)(500 amino acids)
Jiang,Q. Voigt,J.M. and Colby,H.
Molecular Cloning and sequencing of a guinea pig cytochrome P4502D
(CYP2D16): high level expression in adrenal microsomes.
Biochem. Biophys. Res. Commun. 209, 1149-1156 (1995)
CYP2D17 Macaca fasicularis ( cynomolgus monkey)
GenEMBL U38218(1494bp)
Laddison,K.J., Speirs,A., Mankowski,D.C., Tweedie,D. and Lawton,M.
Cloning, Sequencing and expression of the cynomolgus monkey liver cytochrome
P450 that is orthologous to human CYP2D6.
ISSX abstracts number 367 (1995)
94% identity to human 2D6
CYP2D18 rat
GenEMBL U48219, S77859
Kawashima,H. and Strobel,H.W.
cDNA cloning of a novel rat brain cytochrome P450 belonging to the CYP2D
subfamily.
Biochem Biophys Res. Commun. 209, 535-540 (1995)
Kawashima,H., Sequeira, D.J., Nelson, D.R. and Strobel,H.W.
Protein expression and catalytic activity toward imipramine N-
demethylation of
a novel rat brain cytochrome P450 CYP2D18.
Biochem Biophys Res. Commun. submitted
note: this gene was cloned and sequenced from two independent
libraries.
This appears to be a distinct gene from CYP2D4.
CYP2D19 Callithrix jacchus (white-tufted-ear marmoset)
GenEMBL D29822
Igarashi,T., Sakuma,T., Isogai,M., Nagata,R. and Kamataki,T.
Marmoset liver cytochrome P450s: study for expression and molecular
cloning of their cDNAs
Arch. Biochem. Biophys. 339 (1), 85-91 (1997)
CYP2D20 hamster
T. Sakuma
95% identical to CYP2D27
CYP2D20 Syrian hamster
no accession number
Kouichi Kurose
submitted to nomenclature committee 7/13/99
clone name SH2D3
1 amino acid diff with Sakumas sequence
CYP2D21 miniature pig
Cyp2d22 mouse
no accession number
J. Leonard and N. Blume
submitted to nomenclature committee
88% identical to rat 2D4
CYP2D23 rabbit
no accession number
Yukio Yamamoto
submitted to nomenclature committee
Clone name rabbit 2D/Clone I
CYP2D24 rabbit
no accession number
Yukio Yamamoto
submitted to nomenclature committee
Clone name rabbit 2D/Clone II
CYP2D25 Sus scrofa (pig)
GenEMBL Y16417
Postlind, H., Axen, E., Bergman, T. and Wikvall, K. (1997)
Cloning, structure and expression of a cDNA encoding vitamin D3 25-hydroxylase.
Biochem. Biophys. Res. Commun. 241, 491-497.
note: this is a microsomal emzyme different from the mitochondrial CYP27
which also has vitamin D3 25-hydroxylase activity.
Cyp2d26 mouse
GenEMBL ESTs only (68 ESTs see UNIGENE Mm.29064)
MGLLVGDDLWAVVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYS
FYKLQNRYGNVFSLQMAWKPVVVVNGLKAVRELLVTYGEDTSDRPLMPIYNHIGYGHKSK
GVILAPYGPEWREQRRFSVSTLRDFGLGKKSLEQWVTEEAGHLCDAFTKEAEHPFNPSPL
LSKAVSNVIASLIYARRFEYEDPFFNRMLKTLKESLGEDTGFVGEVLNAIPMLLHIPGLP
DKAFPKLNSFIALVNKMLIEHDLTWDPAQPPRDLTDAFLAEVEKAKGNPESSFNDKNLRI
VVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHQEIDEVIGHVRHPEMADQARMPYTN
AVIHEVQRFADIVPTNLPHMTSRDIKFQDFFIPKGTTLIPNLSSVLKDETVWEKPLRFYP
EHFLDAQGHFVKHEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSD
YGIYTMPVTPEPYQLCAVAR
Note: Brian Libby (bjl@jax.org) at The Jackson Laboratory has given his
permission to post sequence data he has on the 2d26 gene and a partial Cyp2d13
gene from mouse. He will make the BAC clone available to anyone who wants it.
The BAC has at least two and maybe more P450 sequences. I am putting a link to
a pdf version of the 2D26 gene sequence file here. It is color coded with
additional information, such as sequencing primers and restriction sites.
CYP2D26 gene sequence
CYP2D27 syrian hamster
no accession number
Kouichi Kurose
95% identical to CYP2D20
submitted to nomenclature committee 6/29/99
CYP2D28 syrian hamster
no accession number
Kouichi Kurose
71% identical to CYP2D27 73% to CYP2D20
clone name SH2D2
submitted to nomenclature committee 7/13/99
CYP2D29 Macaca fuscata (Japanese monkey)
GenEMBL AF301911 (release date March 1, 2001)
Shizuo Narimatsu, Hiroyuki Hichiya, Shigeo Yamamoto, Kazuo Asaoka
Submitted to nomenclature committee Oct. 16, 2000
95% to CYP2D6
CYP2D30 Callithrix jacchus (white-tufted-ear marmoset)
GenEMBL AY082602 (to be released April 1, 2003) bankit450928 Mar. 5 2002
Hichiya,H., Yamamoto,S., Asaoka,K. and Narimatsu,S.
Complementary DNA cloning and characterization of a cytochrome P450
2D enzyme from Marmoset monkey liver
Unpublished
submitted to nomenclature committee 3/5/02
33 diffrerences to 2D19 also from marmoset.
CYP2D31P human
NT_022676.10|Hs3_22832 chromosome 3
2D6 pseudogene fragment I-helix
899650 NQENLV*VVIDLFLGGTDTTATTLCWALIHMIQHGAVQ 899537
2E Subfamily
CYP2E1 human
PIR A60554 (18 amino acids)
Robinson, R.C., Shorr, R.G.L., Varrichio, A., Park, S.S.,
Gelboin, H.V., Miller, H. and Friedman, F.K.
Human liver cytochrome P-450 related to a rat
acetone-inducible, nitrosamine-metabolizing cytochrome
P-450: identification and isolation.
Pharmacology 39, 137-144 (1989)
CYP2E1 Macaca fasicularis (monkey)
GenEMBL S55205 (1508bp) Swiss P33266 (449 amino acids)
PIR S28167 (449 amino acids)
Komori,M., Kikuchi,O., Sakuma,T., Funaki,J., Kitada,M.
and Kamataki,T.
Molecular cloning of monkey liver cytochrome P-450 cDNAs:
similarity of the primary sequences to human cytochromes P-450.
Biochim. Biophys. Acta 1171, 141-146 (1992)
CYP2E1 Mesocricetus auratus (hamster)
GenEMBL D17449 (2512bp)
Sakuma,T., Takai,M., Yokoi,T. and Kamataki,T.
Molecular cloning and sequence analysis of hamster CYP2E1
Biochim. Biophys. Acta 1217, 229-231 (1993)
CYP2E1 hamster
PIR S27176 (34 amino acids)
Puccini, P., Menicagli, S., Longo, V., Santucci, A. and Gervasi,P.G.
Purification and characterization of an acetone-inducible
cytochrome P-450 from hamster liver microsomes.
Biochem. J. 287, 863-870 (1992)
CYP2E1 rat
GenEMBL S48325 (1093bp)
Richardson,T.H., Schenkman,J.B., Turcan,R., Goldfarb,P.S.
and Gibson,G.G.
Molecular cloning of a cDNA for rat diabetes-inducible
cytochrome P450RLM6:hormonal regulation and similarity to
the cytochrome P4502E1 gene.
Xenobiotica 22, 621-631 (1992)
CYP2E1 rat
PIR B27425 (34 amino acids)
Favreau, L.V., Malchoff, D.M., Mole, J.E. and Schenkman, J.B.
Responses to insulin by two forms of rat hepatic microsomal
cytochrome P-450 that undergo major (RLM6) and minor
(RLM5b) elevations in diabetes.
J. Biol. Chem. 262, 14319-14326 (1987)
CYP2E1 rat
GenEMBL AF061442
Yoo,M. and Shin,S.W.
The complete coding sequence of the rat brain cytochrome P450 2E1
Unpublished
Cyp2e1 mouse
GenEMBL L11650 (1827bp) Swiss Q05421 (493 amino acids)
Davis,J.F. and Felder,M.R.
Mouse ethanol-inducible cytochrome P450 (P450IIE1).
Characterization of cDNA clones and testosterone
induction in kidney tissue.
J. Biol. Chem. 268, 24933-24939 (1993)
Cyp2e1 mouse
PIR A21231 (39 amino acids)
Ryskov, A.P., Ivanov, P.L., Kramerov, D.A. and Georgiev, G.P.
Mouse ubiquitous B2 repeat in polysomal and cytoplasmic poly
(A)+RNAs: uniderectional orientation and 3'-end localization.
Nucleic Acids Res. 11, 6541-6558 (1983)